TAP1 antibody

Catalog No. ABIN4952781

Product Details anti-TAP1 Antibody

Target: TAP1 (Transporter 1, ATP-Binding Cassette, Sub-Family B (MDR/TAP) (TAP1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TAP1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogen: Amino acids RSFANEEGEAQKFREKLQEIKTLNQKEAVAYAVN of human TAP1 were used as the immunogen for the TAP1 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the TAP1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the TAP1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for TAP1

Target: TAP1 (Transporter 1, ATP-Binding Cassette, Sub-Family B (MDR/TAP) (TAP1))

Alternative Name: TAP1 (TAP1 Products)

Synonyms: ABC17 antibody, ABCB2 antibody, APT1 antibody, D6S114E antibody, PSF-1 antibody, PSF1 antibody, RING4 antibody, TAP1*0102N antibody, TAP1N antibody, abc17 antibody, abcb2 antibody, apt1 antibody, psf1 antibody, ring4 antibody, tap1a antibody, tap1n antibody, Abcb2 antibody, Ham-1 antibody, Ham1 antibody, MTP1 antibody, TAP antibody, Tap-1 antibody, Y3 antibody, Cim antibody, transporter 1, ATP binding cassette subfamily B member antibody, transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) L homeolog antibody, transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) antibody, TAP1 antibody, tap1.L antibody, Tap1 antibody

Background: Transporter associated with Antigen Processing 1 is a protein that in humans is encoded by the TAP1 gene. The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. And ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The protein encoded by this gene is involved in the pumping of degraded cytosolic peptides across the endoplasmic reticulum into the membrane-bound compartment where class I molecules assemble. Mutations in this gene may be associated with ankylosing spondylitis, insulin-dependent diabetes mellitus, and celiac disease. Two transcript variants encoding different isoforms have been found for this gene.

UniProt: Q03518

Pathways: Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process