UBE2Q2 antibody

Catalog No. ABIN4953007

Product Details anti-UBE2Q2 Antibody

Target: UBE2Q2 (Ubiquitin-Conjugating Enzyme E2Q Family Member 2 (UBE2Q2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UBE2Q2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogen: Amino acids LERLEDTKNNNLLRQQLKWLICELCSLYNLPKHLDVEMLDQ of human UBE2Q2 were used as the immunogen for the UBE2Q2 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the UBE2Q2 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the UBE2Q2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for UBE2Q2

Target: UBE2Q2 (Ubiquitin-Conjugating Enzyme E2Q Family Member 2 (UBE2Q2))

Alternative Name: UBE2Q2 (UBE2Q2 Products)

Synonyms: 3010021M21Rik antibody, zgc:56219 antibody, wu:fi34a03 antibody, RGD1307680 antibody, ube2q2 antibody, ubiquitin conjugating enzyme E2 Q2 antibody, ubiquitin-conjugating enzyme E2Q family member 2 antibody, ubiquitin-conjugating enzyme E2 Q2 antibody, ubiquitin conjugating enzyme E2Q family member 2 L homeolog antibody, UBE2Q2 antibody, Ube2q2 antibody, CpipJ_CPIJ007726 antibody, PTRG_02494 antibody, MGYG_01328 antibody, ube2q2 antibody, ube2q2.L antibody

Background: UBE2Q2 is identified as a putative ubiquitin-conjugating enzyme (E2) in a microarray screen for mitotic regulatory proteins. Its gene is mapped to 15q24.2. It can covalently bind ubiquitin on the active site cysteine within the UBC domain. Inhibition of UBE2Q2 in HeLa cells causes an early mitotic arrest and increases cytotoxicity when the cells are treated with microtubule-inhibiting agents (MIAs). Changes in cell cycle progression and viability are not observed in the absence of MIA treatment, indicating that UBE2Q2 is involved in the response to MIAs rather than performing a more general function in mitosis. Moreover, inhibition of the protein causes cells to undergo a prolonged prophase arrest, suggesting that UBE2Q2 normally functions to antagonize an early mitotic checkpoint. Finally, inhibition of UBE2Q2 also sensitizes cells to the cytotoxic effects of MIAs through caspase-mediated apoptosis that is correlated with PARP1 cleavage.

UniProt: Q8WVN8