Unc5c antibody
-
- Target See all Unc5c Antibodies
- Unc5c (Unc-5 Homolog C (C. Elegans) (Unc5c))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Unc5c antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Antigen affinity
- Immunogen
- Amino acids DLWEAQNFPDGNLSMLAAVLEEMGRHETVVSLAAEGQ of human UNC5C were used as the immunogen for the UNC5C antibody.
- Isotype
- IgG
- Top Product
- Discover our top product Unc5c Primary Antibody
-
-
- Application Notes
- Optimal dilution of the UNC5C antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL
- Restrictions
- For Research Use only
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Storage
- -20 °C
- Storage Comment
- After reconstitution, the UNC5C antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Target
- Unc5c (Unc-5 Homolog C (C. Elegans) (Unc5c))
- Alternative Name
- UNC5C (Unc5c Products)
- Synonyms
- UNC5C antibody, UNC5H3 antibody, 6030473H24 antibody, AI047720 antibody, B130051O18Rik antibody, Unc5h3 antibody, rcm antibody, wu:fb03d07 antibody, unc-5 netrin receptor C antibody, UNC5C antibody, Unc5c antibody, unc5c antibody
- Background
- Netrin receptor UNC5C is a protein that in humans is encoded by the UNC5C gene. This gene product belongs to the UNC-5 family of netrin receptors. Netrins are secreted proteins that direct axon extension and cell migration during neural development. They are bifunctional proteins that act as attractants for some cell types and as repellents for others, and these opposite actions are thought to be mediated by two classes of receptors. The UNC-5 family of receptors mediates the repellent response to netrin, they are transmembrane proteins containing 2 immunoglobulin (Ig)-like domains and 2 type I thrombospondin motifs in the extracellular region.
- UniProt
- O95185
-