WNT7A antibody

Catalog No. ABIN4953110

Product Details anti-WNT7A Antibody

Target: WNT7A (Wingless-Type MMTV Integration Site Family, Member 7A (WNT7A))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This WNT7A antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogen: Amino acids YVLKDKYNEAVHVEPVRASRNKRPTFLKIKK of human WNT7A were used as the immunogen for the WNT7A antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the WNT7A antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the WNT7A antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for WNT7A

Target: WNT7A (Wingless-Type MMTV Integration Site Family, Member 7A (WNT7A))

Alternative Name: WNT7A (WNT7A Products)

Synonyms: wnt7a antibody, AI849442 antibody, Wnt-7a antibody, px antibody, tw antibody, Xwnt-7a antibody, wnt-7a antibody, wnt7a-A antibody, Wnt family member 7A antibody, wingless-type MMTV integration site family, member 7Aa antibody, wingless-type MMTV integration site family, member 7A antibody, wingless-type MMTV integration site family member 7A S homeolog antibody, WNT7A antibody, wnt7aa antibody, Wnt7a antibody, wnt7a.S antibody

Background: This gene is a member of the WNT gene family, which consists of structurally related genes that encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is involved in the development of the anterior-posterior axis in the female reproductive tract, and also plays a critical role in uterine smooth muscle pattering and maintenance of adult uterine function. Mutations in this gene are associated with Fuhrmann and Al-Awadi / Raas - Rothschild / Schinzel phocomelia syndromes.

UniProt: O00755

Pathways: WNT Signaling, Stem Cell Maintenance, Asymmetric Protein Localization