Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

CDK5 antibody (Cyclin-Dependent Kinase 5) (AA 195-292) Primary Antibody

CDK5 Reactivity: Human ELISA, WB Host: Mouse Monoclonal 1A2 unconjugated
Catalog No. ABIN514284
$364.00
Plus shipping costs $45.00
200 μL
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target
    CDK5
    Binding Specificity
    AA 195-292
    • 22
    • 15
    • 15
    • 14
    • 9
    • 8
    • 4
    • 4
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Reactivity
    Human
    • 159
    • 113
    • 101
    • 18
    • 15
    • 15
    • 15
    • 14
    • 13
    • 12
    • 9
    • 9
    • 5
    • 5
    • 3
    • 3
    • 3
    • 2
    • 1
    • 1
    • 1
    Host
    Mouse
    Clonality
    Monoclonal
    Conjugate
    This CDK5 antibody is un-conjugated
    • 99
    • 11
    • 6
    • 5
    • 5
    • 5
    • 5
    • 5
    • 5
    • 4
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    Application
    ELISA, Western Blotting (WB)
    • 117
    • 54
    • 27
    • 27
    • 23
    • 21
    • 19
    • 14
    • 14
    • 4
    • 3
    • 3
    • 1
    Purpose
    Mouse monoclonal antibody raised against a partial recombinant CDK5.
    Cross-Reactivity
    Human
    Immunogen

    immunogen: CDK5 (AAH05115, 195 a.a. ~ 292 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Immunogen Sequence: LANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP

    Clone
    1A2
    Isotype
    IgM kappa
  • Application Notes
    Optimal working dilution should be determined by the investigator.
    Comment

    Product Quality tested by: Antibody Reactive Against Recombinant Protein.

    Restrictions
    For Research Use only
  • Format
    Liquid
    Buffer
    In ascites fluid
    Handling Advice
    Aliquot to avoid repeated freezing and thawing.
    Storage
    -20 °C
    Storage Comment
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Target
    CDK5
    Alternative Name
    CDK5 (CDK5 Antibody Abstract)
    Synonyms
    PSSALRE, AW048668, Crk6, CDK5, CG8203, DmCdk5, Dmel\\CG8203, cdk5, zgc:101604, cyclin dependent kinase 5, cyclin-dependent kinase 5, Cyclin-dependent kinase 5, cyclin-dependent kinase 5 L homeolog, Cyclin-dependent-like kinase 5, CDK5, Cdk5, cdk5, cdk5.L, cdk-5
    Background
    Full Gene Name: cyclin-dependent kinase 5
    Synonyms: PSSALRE
    Gene ID
    1020
    Pathways
    Cell Division Cycle, Regulation of Muscle Cell Differentiation, Synaptic Membrane, Regulation of Cell Size, Skeletal Muscle Fiber Development, Synaptic Vesicle Exocytosis
You are here:
help Support