FOXO3 antibody (Forkhead Box O3) (AA 361-460)

Details for Product anti-FOXO3 Antibody No. ABIN515729
Antigen
  • AF6q21
  • FKHRL1
  • FKHRL1P2
  • FOXO2
  • FOXO3A
  • zgc:92176
  • wu:fb50g02
  • wu:fi33f07
  • Fkhrl1
  • Foxo3a
  • FoxO3A
  • 1110048B16Rik
  • 2010203A17Rik
  • C76856
  • Fkhr2
  • FOXO-3
  • FOXO3
  • foxo3a
  • xfoxo3
  • foxO3
  • foxO
  • forkhead box O3
  • forkhead box O3A
  • forkhead box O3 L homeolog
  • FOXO3
  • foxo3a
  • Foxo3
  • foxo3.L
  • foxo3
  • foxO3
Epitope
AA 361-460
65
44
26
19
17
10
10
10
10
9
9
9
8
8
8
7
7
7
4
3
3
3
2
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Reactivity
Human
378
232
200
14
11
8
8
7
7
6
6
4
3
3
3
1
1
1
Host
Mouse
322
53
7
1
Clonality (Clone)
Monoclonal ()
Conjugate
This FOXO3 antibody is un-conjugated
21
15
15
15
15
15
15
8
7
5
5
5
2
2
2
2
2
1
Application
Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), ELISA, Western Blotting (WB)
273
171
153
79
74
27
18
18
13
9
8
5
4
2
1
1
Options
Purpose Mouse monoclonal antibody raised against a partial recombinant FOXO3A.
Immunogen

immunogen: FOXO3A (AAH21224, 361 a.a. ~ 460 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Immunogen Sequence: PCTVELPRLTDMAGTMNLNDGLTENLMDDLLDNITLPPSQPSPTGGLMQRSSSFPYTTKGSGLGSPTSSFNSTVFGPSSLNSLRQSPMQTIQENKPATFS

Clone 1F6
Isotype IgG2a kappa
Cross-Reactivity Human
Plasmids, Primers & others Plasmids, Primers & others FOXO3 products on genomics-online (e.g. as negative or positive controls)
Antigen
Alternative Name FOXO3 (FOXO3 Antibody Abstract)
Background Full Gene Name: forkhead box O3
Synonyms: AF6q21,DKFZp781A0677,FKHRL1,FKHRL1P2,FOXO2,FOXO3A,MGC12739,MGC31925
Gene ID 2309
Pathways Cell Division Cycle, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Carbohydrate Homeostasis
Application Notes Optimal working dilution should be determined by the investigator.
Comment

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Restrictions For Research Use only
Buffer In 1x PBS, pH 7.4
Handling Advice Aliquot to avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Supplier Images
Image no. 1 for anti-Forkhead Box O3 (FOXO3) (AA 361-460) antibody (ABIN515729) Immunoperoxidase of monoclonal antibody to FOXO3A on formalin-fixed paraffin-embedded...
Image no. 2 for anti-Forkhead Box O3 (FOXO3) (AA 361-460) antibody (ABIN515729) Detection limit for recombinant GST tagged FOXO3A is approximately 0.3ng/ml as a capt...
Image no. 3 for anti-Forkhead Box O3 (FOXO3) (AA 361-460) antibody (ABIN515729) Immunofluorescence of monoclonal antibody to FOXO3 on HeLa cell. [antibody concentrat...
Image no. 4 for anti-Forkhead Box O3 (FOXO3) (AA 361-460) antibody (ABIN515729) Western Blot detection against Immunogen (36.63 KDa) .