ALOX12 antibody (N-Term)
-
- Target See all ALOX12 Antibodies
- ALOX12 (Arachidonate 12-Lipoxygenase (ALOX12))
-
Binding Specificity
- AA 186-231, N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ALOX12 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for Arachidonate 12-lipoxygenase, 12S-type(ALOX12) detection. Tested with WB in Human,Mouse,Rat.
- Sequence
- ALKRVYTLLS SWNCLEDFDQ IFWGQKSALA EKVRQCWQDD ELFSYQ
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Arachidonate 12-lipoxygenase, 12S-type(ALOX12) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: arachidonate 12-lipoxygenase
Protein Name: Arachidonate 12-lipoxygenase, 12S-type - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human 12 Lipoxygenase (186-231aa ALKRVYTLLSSWNCLEDFDQIFWGQKSALAEKVRQCWQDDELFSYQ), different from the related mouse sequence by six amino acids, and from the related rat sequence by seven amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product ALOX12 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Storage
- 4 °C,-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- ALOX12 (Arachidonate 12-Lipoxygenase (ALOX12))
- Alternative Name
- ALOX12 (ALOX12 Products)
- Synonyms
- 15-LOX-1 antibody, 15LOX-1 antibody, 12-LOX antibody, 12S-LOX antibody, LOG12 antibody, ALOX12 antibody, ALOX15 antibody, 9930022G08Rik antibody, Alox12p antibody, P-12LO antibody, 12-LO antibody, zgc:64120 antibody, wu:fb72a11 antibody, arachidonate 15-lipoxygenase antibody, arachidonate 12-lipoxygenase, 12S type antibody, arachidonate 12-lipoxygenase antibody, arachidonate 12-lipoxygenase, 12S-type antibody, ALOX15 antibody, ALOX12 antibody, Alox12 antibody, alox12 antibody, LOC100072916 antibody
- Background
-
ALOX12, Arachidonate 12-lipoxygenase, is an enzyme that in humans is encoded by the ALOX12 gene. By fluorescence in situ hybridization, the ALOX12 gene is located in band 17p13.1. The gene consists of 14 exons with 13 introns and spans approximately 15 kb of DNA Arachidonate 12-lipoxygenase introduces a molecular oxygen into the C-12 position of arachidonic acid to produce 12(S)-hydroperoxy-5,8,10,14-eicosatetraenoic acid. The major pathway of arachidonic acid metabolism in human platelets proceeds via a 12-lipoxygenase enzyme. Expression of the LOG12 gene was detected in human erythroleukemia cells, platelets, and human umbilical vein endothelial cells by reverse transcription-PCR analysis.
Synonyms: 12 Lipoxygenase | ALOX12 | arachidonate 12-lipoxygenase | EC1.13.11.31 | Lipoxin synthase 12-LO | LOG12 | P18054 | Platelet-type lipoxygenase 12 - Gene ID
- 239
- UniProt
- P18054
- Pathways
- Positive Regulation of Endopeptidase Activity
-