LMO1 antibody (C-Term)

Catalog No. ABIN5518772

Product Details anti-LMO1 Antibody

Target: LMO1 (LIM Domain Only 1 (Rhombotin 1) (LMO1))

Binding Specificity: AA 127-156, C-Term

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LMO1 antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Rhombotin-1(LMO1) detection. Tested with WB in Human,Mouse,Rat.

Sequence: DKFFLKNNMI LCQMDYEEGQ LNGTFESQVQ

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Rhombotin-1(LMO1) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: LIM domain only 1
Protein Name: Rhombotin-1

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human LMO1 (127-156aa DKFFLKNNMILCQMDYEEGQLNGTFESQVQ), different from the related mouse sequence by two amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for LMO1

Target: LMO1 (LIM Domain Only 1 (Rhombotin 1) (LMO1))

Alternative Name: LMO1 (LMO1 Products)

Synonyms: DAT antibody, Dat1 antibody, DAT1 antibody, PKDYS antibody, RBTN1 antibody, RHOM1 antibody, TTG1 antibody, Lmo3 antibody, Rbtn-1 antibody, Rbtn1 antibody, Ttg1 antibody, LMO1 antibody, cb524 antibody, wu:fb76g02 antibody, zgc:109794 antibody, solute carrier family 6 (neurotransmitter transporter, dopamine), member 3 antibody, solute carrier family 6 member 3 antibody, LIM domain only 1 antibody, Rhombotin-1 antibody, Slc6a3 antibody, SLC6A3 antibody, LMO1 antibody, Lmo1 antibody, lmo1 antibody, rbtn1 antibody

Background: Rhombotin-1 is a protein that in humans is encoded by the LMO1 gene. This locus encodes a transcriptional regulator that contains two cysteine-rich LIM domains but lacks a DNA-binding domain. LIM domains may play a role in protein interactions, thus the encoded protein may regulate transcription by competitively binding to specific DNA-binding transcription factors. Alterations at this locus have been associated with acute lymphoblastic T-cell leukemia. Chromosomal rearrangements have been observed between this locus and at least two loci, the delta subunit of the T-cell antigen receptor gene and the LIM domain binding 1 gene. Alternatively spliced transcript variants have been described.

Synonyms: LMO1 | LMO-1 | LMO 1 | RBTN 1 | RBTN1 | RHOM 1 | RHOM1 | Rhombotin1 | Rhombotin-1 | Rhombotin 1 | TTG 1 | TTG1 | P25800

Gene ID: 4004

UniProt: P25800

Pathways: Dopaminergic Neurogenesis