LMO1 antibody (C-Term)
-
- Target See all LMO1 Antibodies
- LMO1 (LIM Domain Only 1 (Rhombotin 1) (LMO1))
-
Binding Specificity
- AA 127-156, C-Term
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LMO1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for Rhombotin-1(LMO1) detection. Tested with WB in Human,Mouse,Rat.
- Sequence
- DKFFLKNNMI LCQMDYEEGQ LNGTFESQVQ
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Rhombotin-1(LMO1) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: LIM domain only 1
Protein Name: Rhombotin-1 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human LMO1 (127-156aa DKFFLKNNMILCQMDYEEGQLNGTFESQVQ), different from the related mouse sequence by two amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product LMO1 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Storage
- 4 °C,-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- LMO1 (LIM Domain Only 1 (Rhombotin 1) (LMO1))
- Alternative Name
- LMO1 (LMO1 Products)
- Synonyms
- DAT antibody, Dat1 antibody, DAT1 antibody, PKDYS antibody, RBTN1 antibody, RHOM1 antibody, TTG1 antibody, Lmo3 antibody, Rbtn-1 antibody, Rbtn1 antibody, Ttg1 antibody, LMO1 antibody, cb524 antibody, wu:fb76g02 antibody, zgc:109794 antibody, solute carrier family 6 (neurotransmitter transporter, dopamine), member 3 antibody, solute carrier family 6 member 3 antibody, LIM domain only 1 antibody, Rhombotin-1 antibody, Slc6a3 antibody, SLC6A3 antibody, LMO1 antibody, Lmo1 antibody, lmo1 antibody, rbtn1 antibody
- Background
-
Rhombotin-1 is a protein that in humans is encoded by the LMO1 gene. This locus encodes a transcriptional regulator that contains two cysteine-rich LIM domains but lacks a DNA-binding domain. LIM domains may play a role in protein interactions, thus the encoded protein may regulate transcription by competitively binding to specific DNA-binding transcription factors. Alterations at this locus have been associated with acute lymphoblastic T-cell leukemia. Chromosomal rearrangements have been observed between this locus and at least two loci, the delta subunit of the T-cell antigen receptor gene and the LIM domain binding 1 gene. Alternatively spliced transcript variants have been described.
Synonyms: LMO1 | LMO-1 | LMO 1 | RBTN 1 | RBTN1 | RHOM 1 | RHOM1 | Rhombotin1 | Rhombotin-1 | Rhombotin 1 | TTG 1 | TTG1 | P25800 - Gene ID
- 4004
- UniProt
- P25800
- Pathways
- Dopaminergic Neurogenesis
-