Nanog antibody (Middle Region)

Catalog No. ABIN5518779

Product Details anti-Nanog Antibody

Target: Nanog (NANOG) (Nanog Homeobox (NANOG))

Binding Specificity: AA 115-155, Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Nanog antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Homeobox protein NANOG(NANOG) detection. Tested with WB in Human,Mouse,Rat.

Sequence: QRQKYLSLQQ MQELSNILNL SYKQVKTWFQ NQRMKSKRWQ K

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Homeobox protein NANOG(NANOG) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: Nanog homeobox
Protein Name: Homeobox protein NANOG

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Nanog (115-155aa QRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQK), different from the related mouse sequence by three amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for Nanog

Target: Nanog (NANOG) (Nanog Homeobox (NANOG))

Alternative Name: NANOG (NANOG Products)

Synonyms: 2410002E02Rik antibody, ENK antibody, ecat4 antibody, NANOG antibody, hacp antibody, wu:fd19e04 antibody, wu:fd20a07 antibody, zgc:193933 antibody, Nanog homeobox antibody, nanog homeobox antibody, Nanog antibody, NANOG antibody, nanog antibody

Background: NANOG (pron. nanOg) is a transcription factor critically involved with self-renewal of undifferentiated embryonic stem cells. In humans, this protein is encoded by the NANOG gene. It is mapped to 12p13.31. NANOG is thought to be a key factor in maintaining pluripotency. Moreover, NANOG is also thought to function in concert with other factors such as POU5F1 (Oct-4) and SOX2 to establish ESC identity. The NANOG protein has been found to be a transcriptional activator for the Rex1 promoter, playing a key role in sustaining Rex1 expression. Knockdown of NANOG in embryonic stem cells results in a reduction of Rex1 expression, while forced expression of NANOG stimulates Rex1 expression.

Synonyms: ENK | NANOG | Q9H9S0

Gene ID: 79923

UniProt: Q9H9S0

Pathways: Stem Cell Maintenance