Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

CXCR4 antibody (C-Term)

CXCR4 Reactivity: Human WB Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN5518822
  • Target See all CXCR4 Antibodies
    CXCR4 (Chemokine (C-X-C Motif) Receptor 4 (CXCR4))
    Binding Specificity
    • 24
    • 15
    • 15
    • 12
    • 7
    • 7
    • 6
    • 6
    • 6
    • 5
    • 5
    • 4
    • 4
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 265-294, C-Term
    Reactivity
    • 142
    • 90
    • 72
    • 20
    • 11
    • 9
    • 9
    • 6
    • 4
    • 3
    • 3
    • 3
    • 3
    • 3
    • 2
    • 1
    • 1
    • 1
    Human
    Host
    • 121
    • 20
    • 11
    • 6
    • 1
    Rabbit
    Clonality
    • 131
    • 28
    Polyclonal
    Conjugate
    • 91
    • 8
    • 8
    • 6
    • 5
    • 4
    • 3
    • 3
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    This CXCR4 antibody is un-conjugated
    Application
    • 116
    • 55
    • 45
    • 34
    • 26
    • 25
    • 25
    • 24
    • 18
    • 11
    • 7
    • 6
    • 4
    • 4
    • 3
    • 3
    • 2
    Western Blotting (WB)
    Purpose
    Rabbit IgG polyclonal antibody for C-X-C chemokine receptor type 4(CXCR4) detection. Tested with WB in Human.
    Sequence
    ILLEIIKQGC EFENTVHKWI SITEALAFFH
    Cross-Reactivity (Details)
    No cross reactivity with other proteins.
    Characteristics
    Rabbit IgG polyclonal antibody for C-X-C chemokine receptor type 4(CXCR4) detection. Tested with WB in Human.
    Gene Name: chemokine (C-X-C motif) receptor 4
    Protein Name: C-X-C chemokine receptor type 4
    Purification
    Immunogen affinity purified.
    Immunogen
    A synthetic peptide corresponding to a sequence at the C-terminus of human CXCR4 (265-294aa ILLEIIKQGCEFENTVHKWISITEALAFFH), different from the related mouse sequence by five amino acids, and from the related rat sequence by three amino acids.
    Isotype
    IgG
    Top Product
    Discover our top product CXCR4 Primary Antibody
  • Application Notes
    WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
    Notes: Tested Species: Species with positive results.
    Other applications have not been tested. Optimal dilutions should be determined by end users.
    Comment

    Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Concentration
    500 μg/mL
    Buffer
    Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
    Preservative
    Sodium azide
    Precaution of Use
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Storage
    4 °C,-20 °C
    Storage Comment
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
  • Zhu, Sun, Tan, Xu, Dai, Wang, Fan, Zhou: "Tacrolimus promotes hepatocellular carcinoma and enhances CXCR4/SDF‑1α expression in vivo." in: Molecular medicine reports, Vol. 10, Issue 2, pp. 585-92, (2015) (PubMed).

    Zhang, Qi, Li, Zhang, Xu, Wang, Sun: "Chemokine CXCL12 and its receptor CXCR4 expression are associated with perineural invasion of prostate cancer." in: Journal of experimental & clinical cancer research : CR, Vol. 27, pp. 62, (2009) (PubMed).

  • Target
    CXCR4 (Chemokine (C-X-C Motif) Receptor 4 (CXCR4))
    Alternative Name
    CXCR4 (CXCR4 Products)
    Synonyms
    CD184 antibody, D2S201E antibody, FB22 antibody, HM89 antibody, HSY3RR antibody, LAP3 antibody, LCR1 antibody, LESTR antibody, NPY3R antibody, NPYR antibody, NPYRL antibody, NPYY3R antibody, WHIM antibody, Cmkar4 antibody, PB-CKR antibody, PBSF/SDF-1 antibody, Sdf1r antibody, CXC-R4-B antibody, CXCR-4-B antibody, cd184 antibody, cxcr4 antibody, fb22 antibody, hm89 antibody, hsy3rr antibody, lap3 antibody, lcr1 antibody, lestr antibody, npy3r antibody, npyr antibody, npyrl antibody, npyy3r antibody, xcxcr4 antibody, CXC-R4 antibody, CXCR-4 antibody, d2s201e antibody, whim antibody, CXC-R4-A antibody, CXCR-4-A antibody, xCXCR4 antibody, CXCR4 antibody, cb403 antibody, zgc:109863 antibody, cb824 antibody, C-X-C motif chemokine receptor 4 antibody, chemokine (C-X-C motif) receptor 4 antibody, C-X-C motif chemokine receptor 4 S homeolog antibody, C-X-C chemokine receptor type 4 antibody, C-X-C motif chemokine receptor 4 L homeolog antibody, chemokine (C-X-C motif), receptor 4b antibody, chemokine (C-X-C motif) receptor 4a antibody, CXCR4 antibody, Cxcr4 antibody, cxcr4.S antibody, cxcr4 antibody, LOC100049444 antibody, cxcr4.L antibody, cxcr4b antibody, cxcr4a antibody
    Background
    CXCR4 (Chemokine,CXC Motif, Receptor 4), also known as FUSIN or NPY3R, is a protein that in humans is encoded by the CXCR4 gene. It is the receptor for the CXC chemokine SDF1 that has essential functions on embryo organogenesis, immunological functions and T lymphocyte trafficking. CXCR4 is the only SDF1 receptor identified so far. This suggests that CXCR4 expression is critical for the biological effects of SDF1. CXCR4 is also a seven-transmembrane-spanning, G-protein-coupled receptor for the CXC chemokine PBSF/SDF-1. It functions as a co-receptor for T-cell-line tropic human immunodeficiency virus HIV-1. It was concluded that PBSF/SDF-1 and CXCR4 define a new signalling system for organ vascularization.

    Synonyms: C-X-C chemokine receptor type 4 | CXC-R4 | CXCR-4 | FB22 | Fusin | HM89 | LCR1 | Leukocyte-derived seven transmembrane domain receptor | LESTR Lipopolysaccharide-associated protein 3 | LAP-3 | LPS-associated protein 3 | NPYRL | Stromal cell-derived factor 1 receptor | SDF-1 receptor | CD184 | CXCR4 | P61073
    Gene ID
    7852
    UniProt
    P61073
    Pathways
    Regulation of Cell Size, CXCR4-mediated Signaling Events
You are here:
Support