CXCR4 antibody (C-Term)

Catalog No. ABIN5518822

Product Details anti-CXCR4 Antibody

Target: CXCR4 (Chemokine (C-X-C Motif) Receptor 4 (CXCR4))

Binding Specificity: AA 265-294, C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CXCR4 antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for C-X-C chemokine receptor type 4(CXCR4) detection. Tested with WB in Human.

Sequence: ILLEIIKQGC EFENTVHKWI SITEALAFFH

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for C-X-C chemokine receptor type 4(CXCR4) detection. Tested with WB in Human.
Gene Name: chemokine (C-X-C motif) receptor 4
Protein Name: C-X-C chemokine receptor type 4

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human CXCR4 (265-294aa ILLEIIKQGCEFENTVHKWISITEALAFFH), different from the related mouse sequence by five amino acids, and from the related rat sequence by three amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

References for anti-CXCR4 antibody (ABIN5518822)

Zhu, Sun, Tan, Xu, Dai, Wang, Fan, Zhou: "Tacrolimus promotes hepatocellular carcinoma and enhances CXCR4/SDF‑1α expression in vivo." in: Molecular medicine reports, Vol. 10, Issue 2, pp. 585-92, (2015) (PubMed).

Zhang, Qi, Li, Zhang, Xu, Wang, Sun: "Chemokine CXCL12 and its receptor CXCR4 expression are associated with perineural invasion of prostate cancer." in: Journal of experimental & clinical cancer research : CR, Vol. 27, pp. 62, (2009) (PubMed).

Target Details for CXCR4

Target: CXCR4 (Chemokine (C-X-C Motif) Receptor 4 (CXCR4))

Alternative Name: CXCR4 (CXCR4 Products)

Synonyms: CD184 antibody, D2S201E antibody, FB22 antibody, HM89 antibody, HSY3RR antibody, LAP3 antibody, LCR1 antibody, LESTR antibody, NPY3R antibody, NPYR antibody, NPYRL antibody, NPYY3R antibody, WHIM antibody, Cmkar4 antibody, PB-CKR antibody, PBSF/SDF-1 antibody, Sdf1r antibody, CXC-R4-B antibody, CXCR-4-B antibody, cd184 antibody, cxcr4 antibody, fb22 antibody, hm89 antibody, hsy3rr antibody, lap3 antibody, lcr1 antibody, lestr antibody, npy3r antibody, npyr antibody, npyrl antibody, npyy3r antibody, xcxcr4 antibody, CXC-R4 antibody, CXCR-4 antibody, d2s201e antibody, whim antibody, CXC-R4-A antibody, CXCR-4-A antibody, xCXCR4 antibody, CXCR4 antibody, cb403 antibody, zgc:109863 antibody, cb824 antibody, C-X-C motif chemokine receptor 4 antibody, chemokine (C-X-C motif) receptor 4 antibody, C-X-C motif chemokine receptor 4 S homeolog antibody, C-X-C chemokine receptor type 4 antibody, C-X-C motif chemokine receptor 4 L homeolog antibody, chemokine (C-X-C motif), receptor 4b antibody, chemokine (C-X-C motif) receptor 4a antibody, CXCR4 antibody, Cxcr4 antibody, cxcr4.S antibody, cxcr4 antibody, LOC100049444 antibody, cxcr4.L antibody, cxcr4b antibody, cxcr4a antibody

Background: CXCR4 (Chemokine,CXC Motif, Receptor 4), also known as FUSIN or NPY3R, is a protein that in humans is encoded by the CXCR4 gene. It is the receptor for the CXC chemokine SDF1 that has essential functions on embryo organogenesis, immunological functions and T lymphocyte trafficking. CXCR4 is the only SDF1 receptor identified so far. This suggests that CXCR4 expression is critical for the biological effects of SDF1. CXCR4 is also a seven-transmembrane-spanning, G-protein-coupled receptor for the CXC chemokine PBSF/SDF-1. It functions as a co-receptor for T-cell-line tropic human immunodeficiency virus HIV-1. It was concluded that PBSF/SDF-1 and CXCR4 define a new signalling system for organ vascularization.

Synonyms: C-X-C chemokine receptor type 4 | CXC-R4 | CXCR-4 | FB22 | Fusin | HM89 | LCR1 | Leukocyte-derived seven transmembrane domain receptor | LESTR Lipopolysaccharide-associated protein 3 | LAP-3 | LPS-associated protein 3 | NPYRL | Stromal cell-derived factor 1 receptor | SDF-1 receptor | CD184 | CXCR4 | P61073

Gene ID: 7852

UniProt: P61073

Pathways: Regulation of Cell Size, CXCR4-mediated Signaling Events