DVL1 antibody (Middle Region)

Catalog No. ABIN5518825

Product Details anti-DVL1 Antibody

Target: DVL1 (Dishevelled Segment Polarity Protein 1 (DVL1))

Binding Specificity: AA 401-438, Middle Region

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DVL1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purpose: Rabbit IgG polyclonal antibody for Segment polarity protein dishevelled homolog DVL-1(DVL1) detection. Tested with WB, IHC-P in Human,Rat.

Sequence: APQLEEAPLT VKSDMSAVVR VMQLPDSGLE IRDRMWLK

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Segment polarity protein dishevelled homolog DVL-1(DVL1) detection. Tested with WB, IHC-P in Human,Rat.
Gene Name: dishevelled segment polarity protein 1
Protein Name: Segment polarity protein dishevelled homolog DVL-1

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human DVL1 (401-438aa APQLEEAPLTVKSDMSAVVRVMQLPDSGLEIRDRMWLK), different from the related mouse and rat sequences by one amino acid.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Rat, Predicted Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for DVL1

Target: DVL1 (Dishevelled Segment Polarity Protein 1 (DVL1))

Alternative Name: DVL1 (DVL1 Products)

Synonyms: DVL antibody, DVL1L1 antibody, DVL1P1 antibody, Dvl antibody, mKIAA4029 antibody, dvl-1 antibody, DSH antibody, DVL-1 antibody, dvl1 antibody, dvl2l antibody, Xdsh antibody, dsh1 antibody, dishevelled segment polarity protein 1 antibody, dishevelled, dsh homolog 1 (Drosophila) antibody, microRNA 6808 antibody, dishevelled segment polarity protein 1b antibody, dishevelled segment polarity protein 1 L homeolog antibody, DVL1 antibody, Dvl1 antibody, MIR6808 antibody, dvl1b antibody, dvl1.L antibody

Background: Segment polarity protein dishevelled homolog DVL-1 is a protein that in humans is encoded by the DVL1 gene. DVL1, the human homolog of the Drosophila dishevelled gene (dsh) encodes a cytoplasmic phosphoprotein that regulates cell proliferation, acting as a transducer molecule for developmental processes, including segmentation and neuroblast specification. DVL1 is a candidate gene for neuroblastomatous transformation. The Schwartz-Jampel syndrome and Charcot-Marie-Tooth disease type 2A have been mapped to the same region as DVL1. The phenotypes of these diseases may be consistent with defects which might be expected from aberrant expression of a DVL gene during development.

Synonyms: Dishevelled 1 | Dishevelled | Dishevelled-1 | Dishevelled1 | DSH homolog 1 | Dvl 1 | Dvl | Dvl1 | DVL1L1 | DVL1P1 | DRS2 | O14640

Gene ID: 1855

UniProt: O14640

Pathways: WNT Signaling, Synaptic Membrane, Skeletal Muscle Fiber Development