RANBP2 antibody (C-Term)

Catalog No. ABIN5518951

Product Details anti-RANBP2 Antibody

Target: RANBP2 (RAN Binding Protein 2 (RANBP2))

Binding Specificity: AA 3018-3057, C-Term

Reactivity: Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RANBP2 antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for E3 SUMO-protein ligase RanBP2(RANBP2) detection. Tested with WB in Human,Mouse,Rat.

Sequence: EQLAVRFKTK EVADCFKKTF EECQQNLMKL QKGHVSLAAE

Cross-Reactivity (Details): Predicted Cross Reactivity: human
No cross reactivity with other proteins.
Predicted Cross Reactivity: Species predicted to be fit for the product based on sequence similarities.

Characteristics: Rabbit IgG polyclonal antibody for E3 SUMO-protein ligase RanBP2(RANBP2) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: RAN binding protein 2
Protein Name: E3 SUMO-protein ligase RanBP2

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human RanBP2 (3018-3057aa EQLAVRFKTKEVADCFKKTFEECQQNLMKLQKGHVSLAAE), different from the related mouse sequence by nine amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for RANBP2

Target: RANBP2 (RAN Binding Protein 2 (RANBP2))

Alternative Name: RANBP2 (RANBP2 Products)

Synonyms: ANE1 antibody, IIAE3 antibody, NUP358 antibody, TRP1 antibody, TRP2 antibody, A430087B05Rik antibody, AI256741 antibody, RGD1560047 antibody, RANBP2 antibody, ane1 antibody, nup358 antibody, trp1 antibody, trp2 antibody, RAN binding protein 2 antibody, E3 SUMO-protein ligase RanBP2 antibody, RANBP2 antibody, Ranbp2 antibody, LOC474539 antibody, ranbp2 antibody, LOC100511376 antibody

Background: RAN binding protein 2 (RANBP2) is protein which in humans is encoded by the RANBP2 gene. This gene encodes a very large RAN-binding protein that immunolocalizes to the nuclear pore complex. The protein is a giant scaffold and mosaic cyclophilin-related nucleoporin implicated in the Ran-GTPase cycle. And the encoded protein directly interacts with the E2 enzyme UBC9 and strongly enhances SUMO1 transfer from UBC9 to the SUMO1 target SP100. These findings place sumoylation at the cytoplasmic filaments of the nuclear pore complex and suggest that, for some substrates, modification and nuclear import are linked events. This gene is partially duplicated in a gene cluster that lies in a hot spot for recombination on chromosome 2q.

Synonyms: E3 SUMO-protein ligase RanBP2, 358 kDa nucleoporin, Nuclear pore complex protein Nup358, Nucleoporin Nup358, Ran-binding protein 2, RanBP2, p270, RANBP2, NUP358

Gene ID: 5903

UniProt: P49792

Pathways: Carbohydrate Homeostasis, Regulation of Carbohydrate Metabolic Process, Protein targeting to Nucleus