Antibacterial Peptide LL-37 antibody (PE)

Catalog No. ABIN5565145

Product Details

Target: Antibacterial Peptide LL-37

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: PE

Application: Flow Cytometry (FACS), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunocytochemistry (ICC)

Brand: AssayLite™

Characteristics: Purified antibody validated for specificity and sensitivity.

Purification: Affinity Purified

Immunogen: [LL-37, 37 aa] conjugated to KLH

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Buffer: Lyophilized from PBS pH 7.4, 20 mg/mL BSA, and 0.02 % Sodium Azide

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Target Details

Target: Antibacterial Peptide LL-37

Alternative Name: LL - 37, Antibacterial Peptide

Synonyms: CAP-18 antibody, CAP18 antibody, CRAMP antibody, FALL-39 antibody, FALL39 antibody, LL37 antibody, cathelicidin antimicrobial peptide antibody, CAMP antibody

Gene ID: 820

UniProt: P49913