Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

MRPL55 antibody (Mitochondrial Ribosomal Protein L55) Primary Antibody

MRPL55 Reactivity: Human IHC (p) Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN5583754
$737.33
Plus shipping costs $45.00
100 μL
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target
    MRPL55
    Reactivity
    Human
    • 21
    • 11
    • 4
    • 3
    • 3
    • 3
    • 2
    • 2
    • 1
    • 1
    • 1
    Host
    Rabbit
    • 21
    Clonality
    Polyclonal
    • 21
    Conjugate
    This MRPL55 antibody is un-conjugated
    • 5
    • 4
    • 3
    • 3
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Application
    Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
    • 13
    • 12
    • 6
    • 3
    • 1
    Purpose
    Rabbit polyclonal antibody raised against recombinant MRPL55.
    Cross-Reactivity
    Human
    Immunogen

    immunogen: Recombinant protein corresponding to amino acids of human MRPL55.

    Immunogen Sequence: PVLLVKQDGSTIHIRYREPRRMLAMPIDLDTLSPEERRARLRKREAQLQSRKEYEQELSDDLHVERYRQFWTRTKK

    Isotype
    IgG
  • Application Notes
    Immunohistochemistry (1:10-1:20)
    The optimal working dilution should be determined by the end user.
    Restrictions
    For Research Use only
  • Format
    Liquid
    Buffer
    In PBS, pH 7.2 (40 % glycerol, 0.02 % sodium azide)
    Preservative
    Sodium azide
    Precaution of Use
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Storage
    4 °C,-20 °C
    Storage Comment
    Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Target
    MRPL55
    Alternative Name
    MRPL55 (MRPL55 Antibody Abstract)
    Synonyms
    BcDNA:RH10246, CG14283, Dmel\\CG14283, MRP-L55, tmb, AAVG5835, L55nt, PRO19675, 2810038N09Rik, mitochondrial ribosomal protein L55, mRpL55, MRPL55, Mrpl55
    Background
    Full Gene Name: mitochondrial ribosomal protein L55
    Synonyms: AAVG5835,DKFZp686D1387,L55nt,MGC61802,MRP-L55,PRO19675
    Gene ID
    128308
    UniProt
    Q7Z7F7
You are here:
help Support