MRPL55 antibody (Mitochondrial Ribosomal Protein L55)

Details for Product anti-MRPL55 Antibody No. ABIN5583754
Antigen
Reactivity
Human
24
12
4
3
3
3
2
2
1
1
1
Host
Rabbit
24
Clonality
Polyclonal
Conjugate
This MRPL55 antibody is un-conjugated
4
3
3
1
1
1
1
1
1
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
16
15
8
3
1
Options
Purpose Rabbit polyclonal antibody raised against recombinant MRPL55.
Immunogen

immunogen: Recombinant protein corresponding to amino acids of human MRPL55.

Immunogen Sequence: PVLLVKQDGSTIHIRYREPRRMLAMPIDLDTLSPEERRARLRKREAQLQSRKEYEQELSDDLHVERYRQFWTRTKK

Isotype IgG
Cross-Reactivity Human
Antigen
Alternative Name MRPL55 (MRPL55 Antibody Abstract)
Background Full Gene Name: mitochondrial ribosomal protein L55
Synonyms: AAVG5835,DKFZp686D1387,L55nt,MGC61802,MRP-L55,PRO19675
Gene ID 128308
UniProt Q7Z7F7
Application Notes Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Restrictions For Research Use only
Format Liquid
Buffer In PBS, pH 7.2 (40 % glycerol, 0.02 % sodium azide)
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Supplier Images
Image no. 1 for anti-Mitochondrial Ribosomal Protein L55 (MRPL55) antibody (ABIN5583754) Immunohistochemical staining of human small intestine with MRPL55 polyclonal antibody...