Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

GDF2 antibody (Growth Differentiation Factor 2) (AA 320-419) Primary Antibody

GDF2 Reactivity: Human ELISA, WB Host: Mouse Polyclonal unconjugated
Catalog No. ABIN561027
$398.67
Plus shipping costs $45.00
50 μL
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target
    GDF2
    Binding Specificity
    • 15
    • 7
    • 5
    • 4
    • 4
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 320-419
    Reactivity
    • 52
    • 26
    • 17
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    Human
    Host
    • 42
    • 9
    • 3
    • 1
    Mouse
    Clonality
    • 52
    • 3
    Polyclonal
    Conjugate
    • 26
    • 6
    • 5
    • 3
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    This GDF2 antibody is un-conjugated
    Application
    • 27
    • 26
    • 13
    • 13
    • 11
    • 8
    • 5
    • 3
    • 3
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    ELISA, Western Blotting (WB)
    Purpose
    Mouse polyclonal antibody raised against a partial recombinant GDF2.
    Cross-Reactivity
    Human
    Immunogen

    immunogen: GDF2 (NP_057288, 320 a.a. ~ 419 a.a) partial recombinant protein with GST tag.

    Immunogen Sequence: SAGAGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYE

  • Application Notes
    Optimal working dilution should be determined by the investigator.
    Comment

    Product Quality tested by: Antibody Reactive Against Recombinant Protein.

    Restrictions
    For Research Use only
  • Format
    Liquid
    Buffer
    50 % glycerol
    Handling Advice
    Aliquot to avoid repeated freezing and thawing.
    Storage
    -20 °C
    Storage Comment
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Target
    GDF2
    Alternative Name
    GDF2 (GDF2 Antibody Abstract)
    Synonyms
    bmp9, BMP-9, BMP9, Bmp9, DSL1, growth differentiation factor 2, gdf2, GDF2, Gdf2
    Background
    Full Gene Name: growth differentiation factor 2
    Synonyms: BMP-9,BMP9
    Gene ID
    2658
    NCBI Accession
    NP_057288, NM_016204
    Pathways
    Transition Metal Ion Homeostasis
You are here:
help Support