Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

Inositol Polyphosphate Phosphatase-Like 1 (INPPL1) (AA 1159-1258) antibody Primary Antibody

INPPL1 Reactivity: Human ELISA, WB Host: Mouse Monoclonal 3E6 unconjugated
Catalog No. ABIN561503
$600.00
Plus shipping costs $45.00
100 μg
local_shipping Shipping to: United States
Delivery in 11 to 12 Business Days
  • Target
    Inositol Polyphosphate Phosphatase-Like 1 (INPPL1)
    Binding Specificity
    • 16
    • 16
    • 15
    • 15
    • 8
    • 8
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 1159-1258
    Reactivity
    • 64
    • 58
    • 42
    • 3
    • 3
    • 3
    • 3
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    Human
    Host
    • 76
    • 3
    • 1
    Mouse
    Clonality
    • 78
    • 2
    Monoclonal
    Conjugate
    • 24
    • 5
    • 5
    • 5
    • 5
    • 5
    • 5
    • 5
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    Un-conjugated
    Application
    • 39
    • 39
    • 26
    • 19
    • 16
    • 9
    • 9
    • 4
    • 3
    • 2
    • 1
    ELISA, Western Blotting (WB)
    Purpose
    Mouse monoclonal antibody raised against a partial recombinant INPPL1.
    Cross-Reactivity
    Human
    Immunogen

    immunogen: INPPL1 (NP_001558, 1159 a.a. ~ 1258 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Immunogen Sequence: PSDYGRPLSFPPPRIRESIQEDLAEEAPCLQGGRASGLGEAGMSAWLRAIGLERYEEGLVHNGWDDLEFLSDITEEDLEEAGVQDPAHKRLLLDTLQLSK

    Clone
    3E6
    Isotype
    IgG1 kappa
  • Application Notes
    Optimal working dilution should be determined by the investigator.
    Comment

    Product Quality tested by: Antibody Reactive Against Recombinant Protein.

    Restrictions
    For Research Use only
  • Buffer
    In 1x PBS, pH 7.4
    Handling Advice
    Aliquot to avoid repeated freezing and thawing.
    Storage
    -20 °C
    Storage Comment
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Target
    Inositol Polyphosphate Phosphatase-Like 1 (INPPL1)
    Alternative Name
    INPPL1 (INPPL1 Antibody Abstract)
    Synonyms
    inppl1, si:bz46j2.7, si:rp71-46j2.7, INPPL1, OPSMD, SHIP2, 51C, Ship2, inositol polyphosphate phosphatase-like 1b, inositol polyphosphate phosphatase like 1, phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2B, inositol polyphosphate phosphatase-like 1, inppl1b, INPPL1, LOC100180571, Inppl1
    Background
    Full Gene Name: inositol polyphosphate phosphatase-like 1
    Synonyms: SHIP2
    Gene ID
    3636
    NCBI Accession
    NP_001558, NM_001567
    Pathways
    Platelet-derived growth Factor Receptor Signaling
You are here:
help Support