AGO2 antibody

Catalog No. ABIN5646978

Product Details anti-AGO2 Antibody

Target: AGO2 (Argonaute 2 (AGO2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AGO2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Antigen affinity purified

Immunogen: Amino acids KVSIKWVSCVSLQALHDALSGRLPSVPFETIQALDVVMRHL from the human protein were used as the immunogen for the AGO2 antibody.

Isotype: IgG

Application Details

Application Notes: Western blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: Prior to reconstitution, store at 4°C. After reconstitution, the AGO2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for AGO2

Target: AGO2 (Argonaute 2 (AGO2))

Alternative Name: AGO2 / Argonaute 2 (AGO2 Products)

Synonyms: EIF2C2 antibody, T19E23.7 antibody, T19E23_7 antibody, argonaute 2 antibody, Q10 antibody, Eif2c2 antibody, Argonaute2 antibody, eif2c1 antibody, eif2c2 antibody, 1110029L17Rik antibody, 2310051F07Rik antibody, AI225898 antibody, AL022874 antibody, AW546247 antibody, ENSMUSG00000072493 antibody, Gerp95 antibody, Gm10365 antibody, mKIAA4215 antibody, AGO2 antibody, AG02 antibody, AGO 2 antibody, Ago-2 antibody, Ago2 antibody, CG13452 antibody, CG7439 antibody, Dm Ago2 antibody, Dmel\\CG7439 antibody, ago antibody, ago-2 antibody, ago2 antibody, dAGO2 antibody, dAgo2 antibody, eIF2C2 antibody, argonaute 2, RISC catalytic component antibody, Argonaute family protein antibody, argonaute 2, RISC catalytic component L homeolog antibody, argonaute RISC catalytic subunit 2 antibody, argonaute RISC catalytic component 2 antibody, Argonaute 2 antibody, AGO2 antibody, Ago2 antibody, ago2.L antibody, ago2 antibody

Background: Protein argonaute-2, also known as AGO2, is a protein that in humans is encoded by the EIF2C2 gene. This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, and contains a PAZ domain and a PIWI domain. It may interact with dicer1 and play a role in short-interfering-RNA-mediated gene silencing. Multiple transcript variants encoding different isoforms have been found for this gene.

UniProt: Q9UKV8

Pathways: Fc-epsilon Receptor Signaling Pathway, Regulatory RNA Pathways, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Ribonucleoprotein Complex Subunit Organization