Insulin Receptor antibody (AA 38-76)

Catalog No. ABIN5647071

This Rabbit Polyclonal antibody specifically detects Insulin Receptor in WB. It exhibits reactivity toward Human and Rat.

Quick Overview for Insulin Receptor antibody (AA 38-76) (ABIN5647071)

Target: Insulin Receptor (INSR)

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Insulin Receptor antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Insulin Receptor Antibody

Binding Specificity: AA 38-76

Purification: Antigen affinity purified

Immunogen: Amino acids 38-76 (MDIRNNLTRLHELENCSVIEGHLQILLMFKTRPEDFRDL) from the human protein were used as the immunogen for the Insulin Receptor antibody.

Isotype: IgG

Application Details

Application Notes: Western blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the Insulin Receptor antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for Insulin Receptor

Target: Insulin Receptor (INSR)

Alternative Name: Insulin Receptor / INSR

Background: Insulin receptor is a tetramer of 2 alpha and 2 beta subunits that are coded by a single gene and are joined by disulfide bonds, a mechanism parallel to that of its ligand, insulin. It belongs to the large class of tyrosine kinase receptors. The insulin receptor gene is mapped to 19p13.2. The insulin receptor mediates their activity by causing the addition of a phosphate group to particular tyrosines on certain proteins within a cell. The INSR gene spans more than 120 kb and has 22 exons. Functional studies of the INSR SNPs show no effect on mRNA levels or splicing in peripheral blood leukocytes or on binding of insulin to mononuclear cells.

UniProt: P06213

Pathways: NF-kappaB Signaling, RTK Signaling, AMPK Signaling, Carbohydrate Homeostasis, Regulation of Cell Size, Regulation of Carbohydrate Metabolic Process, Growth Factor Binding, Negative Regulation of Transporter Activity