Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

Insulin Receptor antibody (AA 38-76)

This Rabbit Polyclonal antibody specifically detects Insulin Receptor in WB. It exhibits reactivity toward Human and Rat.
Catalog No. ABIN5647071
$625.62
Plus shipping costs $50.00
100 μg
Shipping to: United States
Delivery in 2 to 4 Business Days

Quick Overview for Insulin Receptor antibody (AA 38-76) (ABIN5647071)

Target

See all Insulin Receptor (INSR) Antibodies
Insulin Receptor (INSR)

Reactivity

  • 205
  • 108
  • 99
  • 16
  • 12
  • 8
  • 7
  • 6
  • 6
  • 6
  • 4
  • 3
  • 2
  • 2
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
Human, Rat

Host

  • 177
  • 39
  • 6
  • 2
  • 1
Rabbit

Clonality

  • 145
  • 80
Polyclonal

Conjugate

  • 132
  • 17
  • 16
  • 6
  • 6
  • 5
  • 4
  • 4
  • 4
  • 4
  • 4
  • 4
  • 2
  • 2
  • 2
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
This Insulin Receptor antibody is un-conjugated

Application

  • 156
  • 77
  • 73
  • 32
  • 28
  • 28
  • 20
  • 17
  • 13
  • 13
  • 9
  • 5
  • 5
  • 4
  • 2
  • 2
  • 2
  • 2
  • 1
  • 1
  • 1
  • 1
Western Blotting (WB)
  • Binding Specificity

    • 16
    • 13
    • 13
    • 11
    • 8
    • 8
    • 8
    • 5
    • 5
    • 5
    • 5
    • 4
    • 4
    • 4
    • 4
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 38-76

    Purification

    Antigen affinity purified

    Immunogen

    Amino acids 38-76 (MDIRNNLTRLHELENCSVIEGHLQILLMFKTRPEDFRDL) from the human protein were used as the immunogen for the Insulin Receptor antibody.

    Isotype

    IgG
  • Application Notes

    Western blot: 0.5-1 μg/mL

    Restrictions

    For Research Use only
  • Buffer

    0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

    Storage

    -20 °C

    Storage Comment

    After reconstitution, the Insulin Receptor antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
  • Target

    Insulin Receptor (INSR)

    Alternative Name

    Insulin Receptor / INSR

    Background

    Insulin receptor is a tetramer of 2 alpha and 2 beta subunits that are coded by a single gene and are joined by disulfide bonds, a mechanism parallel to that of its ligand, insulin. It belongs to the large class of tyrosine kinase receptors. The insulin receptor gene is mapped to 19p13.2. The insulin receptor mediates their activity by causing the addition of a phosphate group to particular tyrosines on certain proteins within a cell. The INSR gene spans more than 120 kb and has 22 exons. Functional studies of the INSR SNPs show no effect on mRNA levels or splicing in peripheral blood leukocytes or on binding of insulin to mononuclear cells.

    UniProt

    P06213

    Pathways

    NF-kappaB Signaling, RTK Signaling, AMPK Signaling, Carbohydrate Homeostasis, Regulation of Cell Size, Regulation of Carbohydrate Metabolic Process, Growth Factor Binding, Negative Regulation of Transporter Activity
You are here:
Chat with us!