Cyclin T1 antibody
-
- Target See all Cyclin T1 (CCNT1) Antibodies
- Cyclin T1 (CCNT1)
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Cyclin T1 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purification
- Antigen affinity purified
- Immunogen
- Amino acids QKQNSKSVPSAKVSLKEYRAKHAEELAAQKRQLENM from the human protein were used as the immunogen for the Cyclin T1 antibody.
- Isotype
- IgG
- Top Product
- Discover our top product CCNT1 Primary Antibody
-
-
- Application Notes
- Western blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL
- Restrictions
- For Research Use only
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Storage
- -20 °C
- Storage Comment
- Prior to reconstitution, store at 4°C. After reconstitution, the Cyclin T1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Target
- Cyclin T1 (CCNT1)
- Alternative Name
- Cyclin T1 (CCNT1 Products)
- Synonyms
- CG6292 antibody, Dmcyclin T antibody, Dmel\\CG6292 antibody, ORE-14 antibody, P-TEFb antibody, anon-74EFc antibody, dT antibody, p124 antibody, Cyclin-T1 antibody, ccnt antibody, cyct1 antibody, CCNT antibody, CYCT1 antibody, HIVE1 antibody, 2810478G24Rik antibody, AI115585 antibody, CycT1 antibody, fi75b02 antibody, si:dkey-18f23.10 antibody, wu:fi75b02 antibody, Cyclin T antibody, cyclin T1 antibody, cyclin T1 L homeolog antibody, CycT antibody, CCNT1 antibody, ccnt1 antibody, Ccnt1 antibody, ccnt1.L antibody
- Background
- Cyclin-T1 is a protein that in humans is encoded by the CCNT1 gene. This gene encodes a member of the highly conserved cyclin C subfamily. The encoded protein tightly associates with cyclin-dependent kinase 9, and is a major subunit of positive transcription elongation factor b (p-TEFb). In humans, there are multiple forms of positive transcription elongation factor b, which may include one of several different cyclins along with cyclin-dependent kinase 9. The complex containing the encoded cyclin and cyclin-dependent kinase 9 acts as a cofactor of human immunodeficiency virus type 1 (HIV-1) Tat protein, and is both necessary and sufficient for full activation of viral transcription. This cyclin and its kinase partner are also involved in triggering transcript elongation through phosphorylation of the carboxy-terminal domain of the largest RNA polymerase II subunit. Overexpression of this gene is implicated in tumor growth. Alternative splicing results in multiple transcript variants.
- UniProt
- O60563
-