FDCSP antibody (AA 18-51)

Catalog No. ABIN5647429

Product Details anti-FDCSP Antibody

Target: FDCSP (C4orf7) (Chromosome 4 Open Reading Frame 7 (C4orf7))

Binding Specificity: AA 18-51

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FDCSP antibody is un-conjugated

Application: Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity purified

Immunogen: Amino acids 18-51 (FPVSQDQEREKRSISDSDELASGFFVFPYPYPFR) from the human protein were used as the immunogen for the FDCSP antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the FDCSP antibody should be determined by the researcher.\. IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the FDCSP antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for FDCSP

Target: FDCSP (C4orf7) (Chromosome 4 Open Reading Frame 7 (C4orf7))

Alternative Name: FDCSP (C4orf7 Products)

Synonyms: FDC-SP antibody, C4orf7 antibody, cDNA sequence BC037156 antibody, follicular dendritic cell secreted protein antibody, BC037156 antibody, FDCSP antibody

Background: FDC-SP or follicular dendritic cell-secreted protein, is a small, secreted protein, located on chromosome 4 in humans. FDC-SP is a 68-amino acid protein containing a signal peptide at its N terminus, which is used for directing the transport of the protein. This protein specifically binds to activated B cells, and functions as a regulator of antibody responses. It is also thought to contribute to tumor metastases by promoting cancer cell migration and invasion.

UniProt: Q8NFU4