ABCB10 antibody (AA 640-678)

Catalog No. ABIN5647439

Product Details anti-ABCB10 Antibody

Target: ABCB10 (ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 10 (ABCB10))

Binding Specificity: AA 640-678

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ABCB10 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Antigen affinity purified

Immunogen: Amino acids 640-678 (QRIAIARALLKNPKILLLDEATSALDAENEYLVQEALDR) from the human protein were used as the immunogen for the ABCB10 antibody.

Isotype: IgG

Application Details

Application Notes: Western blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: Prior to reconstitution, store at 4°C. After reconstitution, the ABCB10 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for ABCB10

Target: ABCB10 (ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 10 (ABCB10))

Alternative Name: ABCB10 (ABCB10 Products)

Synonyms: EST20237 antibody, M-ABC2 antibody, MTABC2 antibody, Abc-me antibody, Abcb12 antibody, ABCB10 antibody, si:dkey-162b3.3 antibody, GB10581 antibody, ATP binding cassette subfamily B member 10 antibody, ATP-binding cassette, sub-family B (MDR/TAP), member 10 antibody, ATP-binding cassette sub-family B member 10, mitochondrial antibody, ABCB10 antibody, Abcb10 antibody, abcb10 antibody, LOC552744 antibody

Background: ABCB10, also known as M-ABC2, is expressed as a 65-kD nonglycosylated mitochondrial membrane protein. This ABCB10 gene is mapped to 1q42.13. The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. And ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The function of this mitochondrial protein is unknown.

UniProt: Q9NRK6