ABCC1 antibody (AA 1493-1528)

Catalog No. ABIN5647441

Product Details anti-ABCC1 Antibody

Target: ABCC1 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 1 (ABCC1))

Binding Specificity: AA 1493-1528

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ABCC1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Antigen affinity purified

Immunogen: Amino acids 1493-1528 (DYTRVIVLDKGEIQEYGAPSDLLQQRGLFYSMAKDA) from the human protein were used as the immunogen for the ABCC1 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the ABCC1 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the ABCC1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for ABCC1

Target: ABCC1 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 1 (ABCC1))

Alternative Name: MRP1 / ABCC1 (ABCC1 Products)

Synonyms: ABC29 antibody, ABCC antibody, GS-X antibody, MRP antibody, MRP1 antibody, Abcc1a antibody, Abcc1b antibody, Mdrap antibody, Mrp1 antibody, Avcc1a antibody, Mrp antibody, ABCC13 antibody, ATP binding cassette subfamily C member 1 antibody, ATP-binding cassette, sub-family C (CFTR/MRP), member 1 antibody, multidrug resistance-associated protein 1 antibody, ABCC1 antibody, Abcc1 antibody, LOC100152428 antibody, LOC100346553 antibody

Background: Multidrug resistance-associated protein 1 (MRP1) is a protein that in humans is encoded by the ABCC1 gene. The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra-and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This full transporter is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a multispecific organic anion transporter, with oxidized glutatione, cysteinyl leukotrienes, and activated aflatoxin B1 as substrates. This protein also transports glucuronides and sulfate conjugates of steroid hormones and bile salts. Alternatively spliced variants of this gene have been described but their full-length nature is unknown.

UniProt: P33527

Pathways: SARS-CoV-2 Protein Interactome