AKR1B10 antibody (AA 285-316)

Catalog No. ABIN5647462

Product Details anti-AKR1B10 Antibody

Target: AKR1B10 (Aldo-Keto Reductase Family 1, Member B10 (Aldose Reductase) (AKR1B10))

Binding Specificity: AA 285-316

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AKR1B10 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity purified

Immunogen: Amino acids 285-316 (EMATILSFNRNWRACNVLQSSHLEDYPFNAEY) from the human protein were used as the immunogen for the AKR1B10 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the AKR1B10 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the AKR1B10 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for AKR1B10

Target: AKR1B10 (Aldo-Keto Reductase Family 1, Member B10 (Aldose Reductase) (AKR1B10))

Alternative Name: AKR1B10 (AKR1B10 Products)

Synonyms: AKR1B11 antibody, AKR1B12 antibody, ALDRLn antibody, ARL-1 antibody, ARL1 antibody, HIS antibody, HSI antibody, 2310005E10Rik antibody, Akr1b16 antibody, AKR antibody, AKR1B10 antibody, Akr1b10 antibody, aldo-keto reductase family 1 member B10 antibody, aldo-keto reductase family 1, member B10 (aldose reductase) antibody, aldo-keto reductase family 1 member B10-like 2 antibody, AKR1B10 antibody, Akr1b10 antibody, AKR1B10L2 antibody, LOC100585902 antibody, LOC100723118 antibody, LOC101107697 antibody

Background: Aldo-keto reductase family 1 member B10 is an enzyme that in humans is encoded by the AKR1B10 gene. This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member can efficiently reduce aliphatic and aromatic aldehydes, and it is less active on hexoses. It is highly expressed in adrenal gland, small intestine, and colon, and may play an important role in liver carcinogenesis.

UniProt: O60218