IBSP antibody

Catalog No. ABIN5647643

Product Details anti-IBSP Antibody

Target: IBSP (Integrin-Binding Sialoprotein (IBSP))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IBSP antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Antigen affinity purified

Immunogen: Amino acids FSMKNLHRRVKIEDSEENGVFKYRPRYYLYKHAYFYPHLKRFPVQ were used as the immunogen for the IBSP antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the IBSP antibody should be determined by the researcher.\. Western Blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the IBSP antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for IBSP

Target: IBSP (Integrin-Binding Sialoprotein (IBSP))

Alternative Name: IBSP / Bone Sialoprotein 2 (IBSP Products)

Synonyms: BNSP antibody, BSP antibody, BSP-II antibody, SP-II antibody, Bsp antibody, BSP II antibody, BSPII antibody, Bsp2 antibody, IBSP antibody, integrin binding sialoprotein antibody, integrin-binding sialoprotein antibody, integrin-binding sialoprotein S homeolog antibody, IBSP antibody, Ibsp antibody, ibsp.S antibody, ibsp antibody

Background: IBSP (integrin-binding sialoprotein) is also known as BSP. The protein encoded by this gene is a major structural protein of the bone matrix. Bone sialoprotein is an acidic glycoprotein of approximately 70 kD that undergoes extensive posttranslational modifications. It constitutes approximately 12 % of the noncollagenous proteins in human bone and is synthesized by skeletal-associated cell types, including hypertrophic chondrocytes, osteoblasts, osteocytes, and osteoclasts. The only extraskeletal site of its synthesis is the trophoblast. This protein binds to calcium and hydroxyapatite via its acidic amino acid clusters, and mediates cell attachment through an RGD sequence that recognizes the vitronectin receptor. The BSP gene is mapped to 4q22.1.

UniProt: P21815