L1CAM antibody

Catalog No. ABIN5647757

Product Details anti-L1CAM Antibody

Target: L1CAM (L1 Cell Adhesion Molecule (L1CAM))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This L1CAM antibody is un-conjugated

Application: Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity purified

Immunogen: Amino acids NMVITWKPLRWMDWNAPQVQYRVQWRPQGTRGPW were used as the immunogen for the L1CAM antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the L1CAM antibody should be determined by the researcher.\. IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the L1CAM antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for L1CAM

Target: L1CAM (L1 Cell Adhesion Molecule (L1CAM))

Alternative Name: L1CAM / NCAM-L1 / CD171 (L1CAM Products)

Synonyms: l1cam-a antibody, CAML1 antibody, CD171 antibody, HSAS antibody, HSAS1 antibody, MASA antibody, MIC5 antibody, N-CAM-L1 antibody, N-CAML1 antibody, NCAM-L1 antibody, S10 antibody, SPG1 antibody, L1 antibody, Hsas antibody, Hyd antibody, NCAML1 antibody, L1 cell adhesion molecule S homeolog antibody, L1 cell adhesion molecule antibody, l1cam.S antibody, L1CAM antibody, L1cam antibody

Background: L1, also known as L1CAM, is a transmembrane protein member of the L1 protein family, encoded by the L1CAM gene. The protein encoded by this gene is an axonal glycoprotein belonging to the immunoglobulin supergene family. The ectodomain, consisting of several immunoglobulin-like domains and fibronectin-like repeats (type III), is linked via a single transmembrane sequence to a conserved cytoplasmic domain. This cell adhesion molecule plays an important role in nervous system development, including neuronal migration and differentiation. Mutations in the gene cause X-linked neurological syndromes known as CRASH (corpus callosum hypoplasia, retardation, aphasia, spastic paraplegia and hydrocephalus). Alternative splicing of this gene results in multiple transcript variants, some of which include an alternate exon that is considered to be specific to neurons.

UniProt: P32004

Pathways: Synaptic Membrane