ABR antibody

Catalog No. ABIN5647965

Product Details anti-ABR Antibody

Target: ABR (Active BCR-Related (ABR))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ABR antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity purified

Immunogen: Amino acids HPFPDHELEDMKMKISALKSEIQKEKANKGQSRAIERL from the human protein were used as the immunogen for the ABR antibody.

Isotype: IgG

Application Details

Application Notes: Western blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: Prior to reconstitution, store at 4°C. After reconstitution, the ABR antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for ABR

Target: ABR (Active BCR-Related (ABR))

Alternative Name: ABR / Active BCR related (ABR Products)

Synonyms: MDB antibody, xabr antibody, 6330400K15Rik antibody, AU042359 antibody, active BCR-related antibody, active BCR-related L homeolog antibody, active BCR-related gene antibody, ABR antibody, abr.L antibody, Abr antibody

Background: This ABR gene encodes a protein that is similar to the protein encoded by the breakpoint cluster region gene located on chromosome 22. The protein encoded by this gene contains a GTPase-activating protein domain, a domain found in members of the Rho family of GTP-binding proteins. Functional studies in mice determined that this protein plays a role in vestibular morphogenesis. Alternatively spliced transcript variants have been reported for this gene.

UniProt: Q12979

Pathways: Neurotrophin Signaling Pathway, Regulation of Leukocyte Mediated Immunity