Regucalcin antibody

Catalog No. ABIN5692930

Product Details anti-Regucalcin Antibody

Target: Regucalcin (RGN)

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Regucalcin antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Brand: Picoband™

Sequence: YSVDAFDYDL QTGQISNRRS VYKLEKEEQI PD

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Regucalcin detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Immunogen: A synthetic peptide corresponding to a sequence of human Regucalcin (YSVDAFDYDLQTGQISNRRSVYKLEKEEQIPD).

Application Details

Application Notes:

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).

Application Details: Western blot, 0.1-0.5 μg/mL
Immunohistochemistry(Paraffin-embedded Section), 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Target Details for Regucalcin

Target: Regucalcin (RGN)

Alternative Name: RGN (RGN Products)

Synonyms: CG1803 antibody, Dmel\\CG1803 antibody, Regucalcin antibody, T1 antibody, GNL antibody, zgc:92078 antibody, smp30 antibody, xsmp-30 antibody, xsmp30 antibody, DyakGE16489 antibody, dyak_GLEANR_17905 antibody, GE16489 antibody, regucalcin antibody, SMP30 antibody, AI265316 antibody, RC antibody, rgn-A antibody, Rc antibody, Reguc antibody, SMP-30 antibody, CG1803 gene product from transcript CG1803-RA antibody, regucalcin antibody, GE16489 gene product from transcript GE16489-RB antibody, regucalcin (senescence marker protein-30) antibody, regucalcin L homeolog antibody, regucalcin antibody, rgn antibody, LOC465598 antibody, RGN antibody, Dyak\regucalcin antibody, Rgn antibody, rgn.L antibody

Background:

Synonyms: Regucalcin, RC, Gluconolactonase, GNL, Senescence marker protein 30, SMP-30, RGN, SMP30

Background: Regucalcin is a protein that in humans is encoded by the RGN gene. The protein encoded by this gene is a highly conserved, calcium-binding protein, that is preferentially expressed in the liver and kidney. It may have an important role in calcium homeostasis. Studies in rat indicate that this protein may also play a role in aging, as it shows age-associated down-regulation. This gene is part of a gene cluster on chromosome Xp11.3-Xp11.23.

UniProt: Q15493