ATF4 antibody

Catalog No. ABIN5693161

Product Details anti-ATF4 Antibody

Target: ATF4 (Activating Transcription Factor 4 (Tax-Responsive Enhancer Element B67) (ATF4))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ATF4 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Brand: Picoband™

Sequence: KELEKKNEAL KERADSLAKE IQYLKDLIEE VRKARGKKRV P

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for ATF4 detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Immunogen: A synthetic peptide corresponding to a sequence of human ATF4 (KELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP).

Application Details

Application Notes:

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).

Application Details: Western blot, 0.1-0.5 μg/mL
Immunohistochemistry(Paraffin-embedded Section), 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

References for anti-ATF4 antibody (ABIN5693161)

Hu, Li, Li: "MARVELD1 Inhibits Nonsense-Mediated RNA Decay by Repressing Serine Phosphorylation of UPF1." in: PLoS ONE, Vol. 8, Issue 6, pp. e68291, (2013) (PubMed).

Target Details for ATF4

Target: ATF4 (Activating Transcription Factor 4 (Tax-Responsive Enhancer Element B67) (ATF4))

Alternative Name: ATF4 (ATF4 Products)

Synonyms: CREB-2 antibody, CREB2 antibody, TAXREB67 antibody, TXREB antibody, ATF4 antibody, atf-4 antibody, creb-2 antibody, creb2 antibody, taxreb67 antibody, txreb antibody, atf4 antibody, wu:fj01c08 antibody, wu:fk30b04 antibody, zgc:85951 antibody, sb:eu681 antibody, wu:fb08f07 antibody, zgc:171702 antibody, Atf-4 antibody, C/ATF antibody, ATF4-I antibody, atf4-a antibody, atf4-b antibody, atf4-ii antibody, activating transcription factor 4 antibody, activating transcription factor 4 L homeolog antibody, activating transcription factor 4a antibody, activating transcription factor 4b antibody, activating transcription factor 4 S homeolog antibody, ATF4 antibody, atf4 antibody, Atf4 antibody, atf4.L antibody, atf4a antibody, atf4b antibody, atf4.S antibody

Background:

Synonyms: Cyclic AMP-dependent transcription factor ATF-4, cAMP-dependent transcription factor ATF-4, Activating transcription factor 4, Cyclic AMP-responsive element-binding protein 2, CREB-2, cAMP-responsive element-binding protein 2, DNA-binding protein TAXREB67, Tax-responsive enhancer element-binding protein 67, TaxREB67, ATF4, CREB2, TXREB

Background: ATF4, Activating Transcription Factor 4, is also known as CREB2. ATF4 belongs to the large ATF/CREB family of transcription factors which bind DNA via their basic region and dimerize via their leucine zipper domain to form a variety of homo- and heterodimers to regulate gene transcription. It is identified that members of this family share significant sequence similarity within a leucine zipper DNA-binding motif and an adjacent basic region. The ATF4 gene is mapped to chromosome 22. Unlike CREB, which activates transcription from CRE-containing promoters, CREB2 functions as a specific repressor of CRE-dependent transcription. The transcriptional repressor activity resides within the C-terminal leucine zipper and basic domain region of the CREB2 protein.

UniProt: P18848

Pathways: Thyroid Hormone Synthesis, Myometrial Relaxation and Contraction, ER-Nucleus Signaling, Unfolded Protein Response