KLF4 antibody

Catalog No. ABIN5693240

Product Details anti-KLF4 Antibody

Target: KLF4 (Kruppel-Like Factor 4 (Gut) (KLF4))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KLF4 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Brand: Picoband™

Sequence: EKTLRQAGAP NNRWREELSH MKRLPPVLPG RPYDLA

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for KLF4 detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Immunogen: A synthetic peptide corresponding to a sequence of human KLF4 (EKTLRQAGAPNNRWREELSHMKRLPPVLPGRPYDLA).

Application Details

Application Notes:

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).

Application Details: Western blot, 0.1-0.5 μg/mL
Immunohistochemistry(Paraffin-embedded Section), 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

References for anti-KLF4 antibody (ABIN5693240)

Ai, Shao, Shi, Yu, Wu, Du, Zhang, Guo: "Maintenance of Self-Renewal and Pluripotency in J1 Mouse Embryonic Stem Cells through Regulating Transcription Factor and MicroRNA Expression Induced by PD0325901." in: Stem cells international, Vol. 2016, pp. 1792573, (2016) (PubMed).

Ai, Shao, Wu, Yu, Du, Shi, Shi, Zhang, Guo: "CHIR99021 enhances Klf4 Expression through β-Catenin Signaling and miR-7a Regulation in J1 Mouse Embryonic Stem Cells." in: PLoS ONE, Vol. 11, Issue 3, pp. e0150936, (2016) (PubMed).

Target Details for KLF4

Target: KLF4 (Kruppel-Like Factor 4 (Gut) (KLF4))

Alternative Name: KLF4 (KLF4 Products)

Synonyms: EZF antibody, GKLF antibody, Gklf antibody, Zie antibody, KLF4 antibody, biklf antibody, biklf-A antibody, Kruppel like factor 4 antibody, Kruppel-like factor 4 (gut) antibody, Kruppel-like factor 4 antibody, Kruppel-like factor 4 (gut) L homeolog antibody, KLF4 antibody, Klf4 antibody, klf4 antibody, klf4.L antibody

Background:

Synonyms: Krueppel-like factor 4, Epithelial zinc finger protein EZF, Gut-enriched krueppel-like factor, KLF4, EZF, GKLF

Background: Kruppel-like factor 4, also known as EZF or GKLF, is a protein that in humans is encoded by the KLF4 gene. This gene is mapped to 9q31.2. KLF4 gene encodes a member of the Kruppel family of transcription factors. This gene plays an important role in maintaining embryonic stem cells, and in preventing their differentiation. It is required for establishing the barrier function of the skin and for postnatal maturation and maintenance of the ocular surface. This gene involved in the differentiation of epithelial cells and may also function in skeletal and kidney development.

UniProt: O43474

Pathways: Peptide Hormone Metabolism, Stem Cell Maintenance