MUC2 antibody

Catalog No. ABIN5693242

Product Details anti-MUC2 Antibody

Target: MUC2 (Mucin 2, Oligomeric Mucus/gel-Forming (MUC2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MUC2 antibody is un-conjugated

Application: Immunohistochemistry (IHC)

Sequence: DDFKTASGLV EATGAGFANT WKAQSTCHDK LDWLDD

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for MUC2 detection. Tested with IHC-P in Human,Mouse,Rat.

Immunogen: A synthetic peptide corresponding to a sequence of human MUC2 (DDFKTASGLVEATGAGFANTWKAQSTCHDKLDWLDD).

Application Details

Application Notes:

Recommended Detection Systems: HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).

Application Details: Immunohistochemistry(Paraffin-embedded Section), 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Target Details for MUC2

Target: MUC2 (Mucin 2, Oligomeric Mucus/gel-Forming (MUC2))

Alternative Name: MUC2 (MUC2 Products)

Synonyms: 2010015E03Rik antibody, MCM antibody, wnn antibody, MLP antibody, MUC-2 antibody, SMUC antibody, HH-Muc antibody, mucin 2 antibody, mucin 2, oligomeric mucus/gel-forming antibody, mucin-2 antibody, Muc2 antibody, MUC2 antibody, LOC100724045 antibody

Background:

Synonyms: Mucin-2, MUC-2, Intestinal mucin-2, MUC2, SMUC

Tissue Specificity: Colon, small intestine, colonic tumors, bronchus, cervix and gall bladder.

Background: Mucin 2, also known as MUC2, is a protein that in humans is encoded by the MUC2 gene. This gene encodes a member of the mucin protein family. It is mapped to 11p15.5. Mucin 2 is particularly prominent in the gut where it is secreted from goblet cells in the epithelial lining into the lumen of the large intestine. There, mucin 2, along with small amounts of related-mucin proteins, polymerizes into a gel of which 80 % by weight is oligosaccharide side-chains that are added as post-translational modifications to the mucin proteins. This gel provides an insoluble mucous barrier that serves to protect the intestinal epithelium. The primary function of the MUC2 gene product is to provide a protective barrier between the epithelial surfaces and the gut lumen. There is decreased expression of MUC2 in colonic cancer and defective polymerization of secreted mucin in ulcerative colitis.

UniProt: Q02817