NFIB antibody

Catalog No. ABIN5708262

Product Details anti-NFIB Antibody

Target: NFIB (Nuclear Factor I/B (NFIB))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NFIB antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity purified

Immunogen: Amino acids ELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQR were used as the immunogen for the NFIB antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the NFIB antibody should be determined by the researcher.\. Western blot: 0.5-1 μg/mL, IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the NFIB antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for NFIB

Target: NFIB (Nuclear Factor I/B (NFIB))

Alternative Name: NFIB / Nuclear factor 1 B-type (NFIB Products)

Synonyms: NFIB antibody, nf1-b1 antibody, CTF antibody, HMGIC/NFIB antibody, NF-I/B antibody, NF1-B antibody, NFI-B antibody, NFI-RED antibody, NFIB2 antibody, NFIB3 antibody, 6720429L07Rik antibody, E030026I10Rik antibody, nuclear factor I B antibody, nuclear factor 1 B-type antibody, nuclear factor I B L homeolog antibody, nuclear factor I/B antibody, NFIB antibody, LOC100221557 antibody, nfib.L antibody, Nfib antibody

Background: Recognizes and binds the palindromic sequence 5'-TTGGCNNNNNGCCAA-3' present in viral and cellular promoters and in the origin of replication of adenovirus type 2. These proteins are individually capable of activating transcription and replication. [UniProt]

UniProt: O00712