Regucalcin antibody

Catalog No. ABIN5708276

Product Details anti-Regucalcin Antibody

Target: Regucalcin (RGN)

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Regucalcin antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity purified

Immunogen: Amino acids YSVDAFDYDLQTGQISNRRSVYKLEKEEQIPD were used as the immunogen for the Regucalcin antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the Regucalcin antibody should be determined by the researcher.\. Western blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the Regucalcin antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for Regucalcin

Target: Regucalcin (RGN)

Alternative Name: Regucalcin (RGN Products)

Synonyms: CG1803 antibody, Dmel\\CG1803 antibody, Regucalcin antibody, T1 antibody, GNL antibody, zgc:92078 antibody, smp30 antibody, xsmp-30 antibody, xsmp30 antibody, DyakGE16489 antibody, dyak_GLEANR_17905 antibody, GE16489 antibody, regucalcin antibody, SMP30 antibody, AI265316 antibody, RC antibody, rgn-A antibody, Rc antibody, Reguc antibody, SMP-30 antibody, CG1803 gene product from transcript CG1803-RA antibody, regucalcin antibody, GE16489 gene product from transcript GE16489-RB antibody, regucalcin (senescence marker protein-30) antibody, regucalcin L homeolog antibody, regucalcin antibody, rgn antibody, LOC465598 antibody, RGN antibody, Dyak\regucalcin antibody, Rgn antibody, rgn.L antibody

Background: Regucalcin is a protein that in humans is encoded by the RGN gene. The protein encoded by this gene is a highly conserved, calcium-binding protein, that is preferentially expressed in the liver and kidney. It may have an important role in calcium homeostasis. Studies in rat indicate that this protein may also play a role in aging, as it shows age-associated down-regulation. This gene is part of a gene cluster on chromosome Xp11.3-Xp11.23.

UniProt: Q15493