PEBP1 antibody

Catalog No. ABIN5708350

Product Details anti-PEBP1 Antibody

Target: PEBP1 (Phosphatidylethanolamine Binding Protein 1 (PEBP1))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PEBP1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity purified

Immunogen: Amino acids DHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQ were used as the immunogen for the RKIP antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the RKIP antibody should be determined by the researcher.\. Western blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the RKIP antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for PEBP1

Target: PEBP1 (Phosphatidylethanolamine Binding Protein 1 (PEBP1))

Alternative Name: RKIP / PEBP1 / PBP (PEBP1 Products)

Synonyms: HCNP antibody, HCNPpp antibody, PBP antibody, PEBP antibody, PEBP-1 antibody, RKIP antibody, pbp antibody, hcnp antibody, pebp antibody, rkip antibody, Pbp antibody, Pbp1 antibody, Pbpr antibody, Rkip antibody, PEBP1 antibody, BcDNA:LP12095 antibody, CG18594 antibody, Dmel\\CG18594 antibody, T2 antibody, zgc:56033 antibody, zgc:76942 antibody, phosphatidylethanolamine binding protein 1 antibody, phosphatidylethanolamine binding protein 1 L homeolog antibody, phosphatidylethanolamine-binding protein antibody, phosphatidylethanolamine-binding protein,putative antibody, Phosphatidylethanolamine-binding protein 1 antibody, PEBP1 antibody, pebp1 antibody, Pebp1 antibody, pebp1.L antibody, RR_RS07785 antibody, PVX_235290 antibody, PVX_123630 antibody, PKH_143640 antibody, EAM_1207 antibody

Background: PEBP1 (Phosphatidylethanolamine-binding protein 1), also called PBP, RKIP, inhibits the phosphorylation and activation of MEK by RAF1. PEBP1 is identical to the phosphatidylethanolamine-binding protein (PBP) with a relative molecular mass of 23 kD. The PEBP1 gene is mapped on 12q24.23. PEBP1 coimmunoprecipitates with RAF1 and MEK from cell lysates and colocalizes with RAF1 when examined by confocal microscopy. PEBP1 overexpression interferes with the activation of MEK and ERK, induction of AP1-dependent reporter genes, and transformation elicited by an oncogenically activated RAF1 kinase. PEBP1 expression was rapidly upregulated during induction of chemotherapy-triggered apoptosis in human prostate and breast cancer cell lines, and maximal RKIP expression correlated perfectly with the onset of apoptosis by Chatterjee et al (2004). RKIP depletion decreased the mitotic index, the number of metaphase cells, traversal times from nuclear envelope breakdown to anaphase, and an override of mitotic checkpoints induced by spindle poisons.

UniProt: P30086

Pathways: Feeding Behaviour