14-3-3 zeta antibody

Catalog No. ABIN5708416

Product Details anti-14-3-3 zeta Antibody

Target: 14-3-3 zeta (YWHAZ)

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This 14-3-3 zeta antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity purified

Immunogen: Amino acids LLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQ were used as the immunogen for the 14-3-3 zeta antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the 14-3-3 zeta antibody should be determined by the researcher.\. Western blot: 0.5-1 μg/mL, IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the 14-3-3 zeta antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for 14-3-3 zeta

Target: 14-3-3 zeta (YWHAZ)

Alternative Name: 14-3-3 zeta / YWHAZ (YWHAZ Products)

Synonyms: 14-3-3-zeta antibody, KCIP-1 antibody, YWHAD antibody, 14-3-3zeta antibody, Ywhaz antibody, ACYPI003154 antibody, 14-3-3z antibody, kcip-1 antibody, ywhaq antibody, 1433z antibody, ywhaz antibody, ywhazb antibody, 1110013I11Rik antibody, AI596267 antibody, AL022924 antibody, AU020854 antibody, ywhaza antibody, fb14h09 antibody, wu:fb05g08 antibody, wu:fb14h09 antibody, ywhai antibody, zgc:55807 antibody, 14-3-3 antibody, 14-3-3 zeta antibody, 14-3-3ZETA antibody, 14-3-3leo antibody, 2G1 antibody, 4-3-3 zeta antibody, 5.11 antibody, 549 antibody, BEST:GH05075 antibody, CG17870 antibody, D14-3-3 antibody, D14-3-3zeta antibody, Dmel\\CG17870 antibody, K antibody, LEO antibody, Leo antibody, PAR-5 antibody, PAR5 antibody, Par-5 antibody, d14-3-3zeta antibody, l(2)07103 antibody, l(2)46CFe antibody, l(2)46Ee antibody, leo antibody, par-5 antibody, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta antibody, 14-3-3 protein zeta antibody, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta L homeolog antibody, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide antibody, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta antibody, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta S homeolog antibody, 14-3-3 protein zeta/delta pseudogene antibody, CG17870 gene product from transcript CG17870-RE antibody, YWHAZ antibody, 14-3-3zeta antibody, ywhaz antibody, 1433z antibody, ywhaz.L antibody, Ywhaz antibody, ywhaz.S antibody, LOC100855903 antibody

Background: 14-3-3 protein zeta/delta is a protein that in humans is encoded by the YWHAZ gene on chromosome 8. This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99 % identical to the mouse, rat and sheep orthologs. The encoded protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity. Several transcript variants that differ in the 5' UTR but that encode the same protein have been identified for this gene.

UniProt: P63104

Pathways: Apoptosis, Hormone Transport, Myometrial Relaxation and Contraction, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Synaptic Membrane, Production of Molecular Mediator of Immune Response, Maintenance of Protein Location