Ataxin 1 antibody (AA 164-197) (HRP)
-
- Target See all Ataxin 1 (ATXN1) Antibodies
- Ataxin 1 (ATXN1)
-
Binding Specificity
- AA 164-197
-
Reactivity
- Human, Mouse, Rat
-
Host
- Mouse
-
Clonality
- Monoclonal
-
Conjugate
- This Ataxin 1 antibody is conjugated to HRP
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC), Immunoprecipitation (IP), Immunofluorescence (fixed cells) (IF/ICC)
- Sequence
- ATTPSQRSQL EAYSTLLANM GSLSQAPGHK VEPP
- Purification
- Protein G Purified
- Immunogen
- Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical)..
- Isotype
- IgG2b
- Top Product
- Discover our top product ATXN1 Primary Antibody
-
-
- Application Notes
- Optimal working dilution should be determined by the investigator.
- Restrictions
- For Research Use only
-
- Format
- Liquid
- Concentration
- 1 mg/mL
- Buffer
- PBS pH 7.4, 50 % glycerol, 0.1 % sodium azide
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Storage
- -20 °C
- Storage Comment
- Store at -20°C.
-
- Target
- Ataxin 1 (ATXN1)
- Alternative Name
- Ataxin 1 (ATXN1 Products)
- Synonyms
- ATX1 antibody, D6S504E antibody, SCA1 antibody, ATXN1 antibody, ataxin 1b antibody, atxn1 antibody, 2900016G23Rik antibody, Atx1 antibody, C85907 antibody, ENSMUSG00000074917 antibody, Gm10786 antibody, Sca1 antibody, CG4547 antibody, Dmel\\CG4547 antibody, dAtx-1 antibody, dAtx1 antibody, sca1 antibody, ataxin 1 antibody, ataxin 1b antibody, Ataxin 1 antibody, ATXN1 antibody, atxn1b antibody, Atxn1 antibody, Atx-1 antibody
- Gene ID
- 20238
- UniProt
- P54254
- Pathways
- Synaptic Membrane
-