PTH antibody (AA 1-38)

Catalog No. ABIN600073

Product Details anti-PTH Antibody

Target: PTH (Parathyroid Hormone (PTH))

Binding Specificity: AA 1-38

Reactivity: Human, Monkey

Host: Mouse

Clonality: Monoclonal

Conjugate: This PTH antibody is un-conjugated

Application: Immunohistochemistry (IHC), ELISA, Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Radioimmunoassay (RIA), Immunohistochemistry (Frozen Sections) (IHC (fro))

Specificity: Human PTH peptide (aa 15-25, 1-34, 1-38, 1-84, 7-84). There were no cross reactivities obtained with synthetic human PTH (aa 1-3, 1-10, 4-16, 28-48, 39-84, 44-68, 53-84,), PTHrP (aa 1-86).

Predicted Reactivity: Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%) Horse (97%) Elephant, Panda, Dog, Pig (94%) Bovine (90%) Hamster, Cat (87%) Rat (84%) Mouse (81%).

Purification: Protein G purified

Immunogen: Synthetic human PTH (aa 1-38) polylysine conjugated(SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALG). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%), Horse (97%), Elephant, Panda, Dog, Pig (94%), Bovine (90%), Hamster, Cat (87%), Rat (84%), Mouse (81%).

Clone: B2-82

Isotype: IgG1

Application Details

Application Notes: Approved: ELISA (1 μg/mL), IHC, IHC-Fr, IHC-P, RIA

Usage: Suitable for use in ELISA: 1 μg/mL. Immunohistochemistry: 2 μg/mL. Frozen, paraffin. RIA: 25 ng/mL.

Comment:

Target Species of Antibody: Human

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Sterile distilled water

Concentration: Lot specific

Buffer: Lyophilized from in 50 mM Tris,  pH 7.2

Handling Advice: Aliquot to Avoid repeated freezing and thawing.

Storage: -20 °C

Storage Comment: Lyophilized powder may be stored at -20°C. Stable for 1 year at -20°C. Aliquot to avoid freeze-thaw cycles. Store at -20°C. Reconstituted product is stable for 1 year at -20°C.

Target Details for PTH

Target: PTH (Parathyroid Hormone (PTH))

Alternative Name: Parathyroid Hormone / PTH (PTH Products)

Synonyms: PTH1 antibody, Pthp antibody, PTH-(1-84) antibody, Pth1 antibody, Pthr1 antibody, PTH antibody, parathyroid hormone antibody, parathyroid hormone S homeolog antibody, PTH antibody, Pth antibody, pth.S antibody

Target Type: Hormone

Background: Name/Gene ID: PTH
Family: Hormone

Synonyms: PTH, Parathyroid hormone, Parathyroid hormone 1, Parathyrin, Parathormone, PTH1

Gene ID: 5741

UniProt: P01270

Pathways: cAMP Metabolic Process, Regulation of Carbohydrate Metabolic Process