Spermidine Synthase antibody (Internal Region)

Catalog No. ABIN6265256

Product Details anti-Spermidine Synthase Antibody

Target: Spermidine Synthase (SRM)

Binding Specificity: Internal Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Spermidine Synthase antibody is un-conjugated

Application: Western Blotting (WB), ELISA

Sequence: MEPGPDGPAASGPAAIREGWFRETCSLWPGQALSLQVEQLLHHRRSRYQDILVFRSKTYGNVLVLDGVIQCTERDEFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVESVVQCEIDEDVIQVSKKFLPGMAIGYSSSKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMGPAESLFKESYYQLMKTALKEDGVLCCQGECQWLHLDLIKEMRQFCQSLFPVVAYAYCTIPTYPSGQIGFMLCSKNPSTNFQEPVQPLTQQQVAQMQLKYYNSDVHRAAFVLPEFARKALNDVS

Specificity: SPEE Antibody detects endogenous levels of total SPEE.

Predicted Reactivity: Pig,Zebrafish,Bovine,Horse,Sheep,Dog,Chicken,Xenopus

Purification: The antiserum was purified by peptide affinity chromatography using SulfoLink^TM Coupling Resin (Thermo Fisher Scientific).

Immunogen: A synthesized peptide derived from human SPEE, corresponding to a region within the internal amino acids.

Isotype: IgG

Application Details

Application Notes: WB 1:1000-3000, ELISA(peptide) 1:20000-1:40000

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: 1 mg/mL

Buffer: Rabbit IgG in phosphate buffered saline , pH 7.4, 150 mM NaCl, 0.02 % sodium azide and 50 % glycerol.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: -20 °C

Storage Comment: Store at -20 °C. Stable for 12 months from date of receipt.

Expiry Date: 12 months

Target Details for Spermidine Synthase

Target: Spermidine Synthase (SRM)

Alternative Name: SRM (SRM Products)

Synonyms: PAPT antibody, SPDSY antibody, SPS1 antibody, SRML1 antibody, AA407669 antibody, SpdST antibody, SpdSy antibody, CG8327 antibody, Dmel\\CG8327 antibody, id:ibd1177 antibody, wu:fa18b03 antibody, zgc:63600 antibody, SRM antibody, MGC83147 antibody, spermidine synthase antibody, Spermidine Synthase antibody, spermidine synthase L homeolog antibody, Spermidine synthase antibody, SRM antibody, Srm antibody, SpdS antibody, srm antibody, srm.L antibody, PF11_0301 antibody, Slip_1383 antibody, Trad_0403 antibody, speE antibody, Sgly_3176 antibody, Dester_0228 antibody, Fluta_3641 antibody, Mahau_0960 antibody

Background: Catalyzes the production of spermidine from putrescine and decarboxylated S-adenosylmethionine (dcSAM). Has a strong preference for putrescine as substrate, and has very low activity towards 1,3-diaminopropane. Has extremely low activity towards spermidine.

Molecular Weight: 33 kDa

Gene ID: 6723

UniProt: P19623