PRIM2 antibody

Catalog No. ABIN629585

Product Details anti-PRIM2 Antibody

Target: PRIM2 (Primase, DNA, Polypeptide 2 (58kDa) (PRIM2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PRIM2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: PRIM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids QDFLKDSQLQFEAISDEEKTLREQEIVASSPSLSGLKLGFKSIYKPPFAS

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PRIM2 Blocking Peptide, catalog no. 33R-7496, is also available for use as a blocking control in assays to test for specificity of this PRIM2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRIM2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PRIM2

Target: PRIM2 (Primase, DNA, Polypeptide 2 (58kDa) (PRIM2))

Alternative Name: PRIM2 (PRIM2 Products)

Synonyms: prim2a antibody, AI323589 antibody, Pola3 antibody, PRIM2A antibody, p58 antibody, DNA primase subunit 2 antibody, DNA primase, p58 subunit antibody, prim2 antibody, Prim2 antibody, PRIM2 antibody

Background: The replication of DNA in eukaryotic cells is carried out by a complex chromosomal replication apparatus, in which DNA polymerase alpha and primase are two key enzymatic components. Primase, which is a heterodimer of a small subunit and a large subunit, synthesizes small RNA primers for the Okazaki fragments made during discontinuous DNA replication.

Molecular Weight: 37 kDa (MW of target protein)

Pathways: Telomere Maintenance, Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA, SARS-CoV-2 Protein Interactome