ICEF1 antibody (C-Term)
-
- Target See all ICEF1 (IPCEF1) Antibodies
- ICEF1 (IPCEF1) (Interaction Protein For Cytohesin Exchange Factors 1 (IPCEF1))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ICEF1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PIP3-E antibody was raised against the C terminal of PIP3-E
- Purification
- Purified
- Immunogen
- PIP3-E antibody was raised using the C terminal of PIP3-E corresponding to a region with amino acids DDPKLTARKYREWKVMNTLLIQDIYQQQRASPAPDDTDDTPQELKKSPSS
- Top Product
- Discover our top product IPCEF1 Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PIP3-E Blocking Peptide, catalog no. 33R-1886, is also available for use as a blocking control in assays to test for specificity of this PIP3-E antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIP3-E antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ICEF1 (IPCEF1) (Interaction Protein For Cytohesin Exchange Factors 1 (IPCEF1))
- Alternative Name
- PIP3-E (IPCEF1 Products)
- Synonyms
- PIP3-E antibody, RP3-402L9.2 antibody, A130090K04Rik antibody, interaction protein for cytohesin exchange factors 1 antibody, IPCEF1 antibody, Ipcef1 antibody
- Background
- PIP3-E enhances the promotion of guanine-nucleotide exchange by PSCD2 on ARF6 in a concentration-dependent manner.
- Molecular Weight
- 44 kDa (MW of target protein)
-