MBD2 antibody (Middle Region)

Catalog No. ABIN629604

Product Details anti-MBD2 Antibody

Target: MBD2 (Methyl-CpG Binding Domain Protein 2 (MBD2))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MBD2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MBD2 antibody was raised against the middle region of MBD2

Purification: Purified

Immunogen: MBD2 antibody was raised using the middle region of MBD2 corresponding to a region with amino acids DCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNT

Application Details

Application Notes: WB: 0.625 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MBD2 Blocking Peptide, catalog no. 33R-1873, is also available for use as a blocking control in assays to test for specificity of this MBD2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MBD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MBD2

Target: MBD2 (Methyl-CpG Binding Domain Protein 2 (MBD2))

Alternative Name: MBD2 (MBD2 Products)

Synonyms: MBD2 antibody, DMTase antibody, NY-CO-41 antibody, MBD2a antibody, wu:fa97f06 antibody, zgc:111862 antibody, methyl-CpG binding domain protein 2 antibody, methyl-CpG binding domain protein 2 S homeolog antibody, MBD2 antibody, Mbd2 antibody, mbd2 antibody, mbd2.S antibody

Background: MBD2 belongs to a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MBD2 can also repress transcription from methylated gene promoters. MBD2 may function as a mediator of the biological consequences of the methylation signal. It is also reported that the MBD2 functions as a demethylase to activate transcription, as DNA methylation causes gene silencing. DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development.

Molecular Weight: 32 kDa (MW of target protein)

Pathways: Chromatin Binding