Pyrophosphatase (Inorganic) 1 (PPA1) antibody
-
- Target See all Pyrophosphatase (Inorganic) 1 (PPA1) Antibodies
- Pyrophosphatase (Inorganic) 1 (PPA1)
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- Un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogen
- PPA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PRWSNAKMEIATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQT
- Top Product
- Discover our top product PPA1 Primary Antibody
-
-
- Application Notes
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PPA1 Blocking Peptide, catalog no. 33R-7346, is also available for use as a blocking control in assays to test for specificity of this PPA1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPA1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Pyrophosphatase (Inorganic) 1 (PPA1)
- Alternative Name
- PPA1 (PPA1 Products)
- Synonyms
- ppa antibody, SCE9.16 antibody, PSPTO0722 antibody, AO090005001437 antibody, IOPPP antibody, PP antibody, PP1 antibody, SID6-8061 antibody, 2010317E03Rik antibody, Pyp antibody, Pp antibody, inorganic pyrophosphatase antibody, Inorganic pyrophosphatase antibody, pyrophosphatase (inorganic) 1 L homeolog antibody, pyrophosphatase (inorganic) 1 antibody, ppa antibody, SCO3409 antibody, ppa-1 antibody, APE_1692.1 antibody, AOR_1_2492174 antibody, Celal_2154 antibody, Celly_1958 antibody, Dester_1338 antibody, Marky_0054 antibody, Halhy_5834 antibody, ppa1.L antibody, PPA1 antibody, Ppa1 antibody
- Target Type
- Viral Protein
- Background
- PPA1 is a member of the inorganic pyrophosphatase (PPase) family. PPases catalyze the hydrolysis of pyrophosphate to inorganic phosphate, which is important for the phosphate metabolism of cells. Studies of a similar protein in bovine suggested a cytoplasmic localization of this enzyme.
- Molecular Weight
- 33 kDa (MW of target protein)
-