ALG1L6P antibody (C-Term)

Catalog No. ABIN629659

Product Details anti-ALG1L6P Antibody

Target: ALG1L6P (Asparagine-Linked Glycosylation 1 Homolog Pseudogene (ALG1L6P))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ALG1L6P antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LOC339879 antibody was raised against the C terminal of LOC339879

Purification: Purified

Immunogen: LOC339879 antibody was raised using the C terminal of LOC339879 corresponding to a region with amino acids HELVKHEENGLVFEDSEELAAQLQMLFSNFPDPAGKLNQFRKNLQESQQL

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LOC339879 Blocking Peptide, catalog no. 33R-3720, is also available for use as a blocking control in assays to test for specificity of this LOC339879 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LOC339879 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ALG1L6P

Target: ALG1L6P (Asparagine-Linked Glycosylation 1 Homolog Pseudogene (ALG1L6P))

Alternative Name: LOC339879 (ALG1L6P Products)

Synonyms: asparagine-linked glycosylation 1-like 6, pseudogene antibody, ALG1L6P antibody

Background: The function of LOC339879 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 36 kDa (MW of target protein)