ECHS1 antibody (Middle Region)
-
- Target See all ECHS1 Antibodies
- ECHS1 (Enoyl CoA Hydratase, Short Chain, 1, Mitochondrial (ECHS1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ECHS1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ECHS1 antibody was raised against the middle region of ECHS1
- Purification
- Purified
- Immunogen
- ECHS1 antibody was raised using the middle region of ECHS1 corresponding to a region with amino acids RAVGKSLAMEMVLTGDRISAQDAKQAGLVSKICPVETLVEEAIQCAEKIA
- Top Product
- Discover our top product ECHS1 Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ECHS1 Blocking Peptide, catalog no. 33R-7826, is also available for use as a blocking control in assays to test for specificity of this ECHS1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ECHS1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ECHS1 (Enoyl CoA Hydratase, Short Chain, 1, Mitochondrial (ECHS1))
- Alternative Name
- ECHS1 (ECHS1 Products)
- Synonyms
- SCEH antibody, cOR6not antibody, fj55e05 antibody, si:zc217g15.1 antibody, wu:fj55e05 antibody, C80529 antibody, enoyl-CoA hydratase, short chain, 1, mitochondrial L homeolog antibody, enoyl-CoA hydratase, short chain 1 antibody, enoyl CoA hydratase, short chain, 1, mitochondrial antibody, enoyl Coenzyme A hydratase, short chain, 1, mitochondrial antibody, echs1.L antibody, ECHS1 antibody, Echs1 antibody, echs1 antibody
- Background
- ECHS1 functions in the second step of the mitochondrial fatty acid beta-oxidation pathway. It catalyzes the hydration of 2-trans-enoyl-coenzyme A (CoA) intermediates to L-3-hydroxyacyl-CoAs. ECHS1 is a member of the hydratase/isomerase superfamily. It localizes to the mitochondrial matrix.
- Molecular Weight
- 28 kDa (MW of target protein)
- Pathways
- Monocarboxylic Acid Catabolic Process
-