GOT1 antibody

Catalog No. ABIN629686

Product Details anti-GOT1 Antibody

Target: GOT1 (Glutamic-Oxaloacetic Transaminase 1, Soluble (Aspartate Aminotransferase 1) (GOT1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GOT1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: GOT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWV

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GOT1 Blocking Peptide, catalog no. 33R-5715, is also available for use as a blocking control in assays to test for specificity of this GOT1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GOT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GOT1

Target: GOT1 (Glutamic-Oxaloacetic Transaminase 1, Soluble (Aspartate Aminotransferase 1) (GOT1))

Alternative Name: GOT1 (GOT1 Products)

Synonyms: ASTQTL1 antibody, GIG18 antibody, cAspAT antibody, cCAT antibody, AST antibody, ISSD antibody, NSD antibody, SD antibody, SIALIN antibody, SIASD antibody, SLD antibody, xr406 antibody, CASPAT antibody, ASPARTATE AMINOTRANSFERASE antibody, ATAAT antibody, MATERNAL EFFECT EMBRYO ARREST 17 antibody, MEE17 antibody, T26C19.9 antibody, T26C19_9 antibody, aspartate aminotransferase antibody, aatA antibody, 83.t00021 antibody, AI789014 antibody, Got-1 antibody, Aspat antibody, Gaspat antibody, AL022787 antibody, FABP-pm antibody, Got-2 antibody, mAspAT antibody, ASPATA antibody, glutamic-oxaloacetic transaminase 1 antibody, solute carrier family 17 member 5 antibody, glutamic-oxaloacetic transaminase 1 homeolog antibody, aspartate aminotransferase antibody, glutamic-oxaloacetic transaminase 1, soluble antibody, glutamic-oxaloacetic transaminase 2 antibody, glutamatic-oxaloacetic transaminase 2, mitochondrial antibody, GOT1 antibody, SLC17A5 antibody, got1.S antibody, AAT antibody, aspC antibody, EHI_006080 antibody, AST2 antibody, ast2 antibody, got1 antibody, Got1 antibody, GOT2 antibody, Got2 antibody

Background: Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology.

Molecular Weight: 46 kDa (MW of target protein)

Pathways: Hepatitis C, Monocarboxylic Acid Catabolic Process, Methionine Biosynthetic Process