GOT1 antibody

Catalog No. ABIN629686

This Rabbit Polyclonal antibody specifically detects GOT1 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for GOT1 antibody (ABIN629686)

Target: GOT1 (Glutamic-Oxaloacetic Transaminase 1, Soluble (Aspartate Aminotransferase 1) (GOT1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GOT1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-GOT1 Antibody

Purification: Purified

Immunogen: GOT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWV

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GOT1 Blocking Peptide, (ABIN5613825), is also available for use as a blocking control in assays to test for specificity of this GOT1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GOT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GOT1

Target: GOT1 (Glutamic-Oxaloacetic Transaminase 1, Soluble (Aspartate Aminotransferase 1) (GOT1))

Alternative Name: GOT1

Background: Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology.

Molecular Weight: 46 kDa (MW of target protein)

Pathways: Hepatitis C, Monocarboxylic Acid Catabolic Process, Methionine Biosynthetic Process