NDUFV1 antibody

Catalog No. ABIN629687

Product Details anti-NDUFV1 Antibody

Target: NDUFV1 (NADH Dehydrogenase (Ubiquinone) Flavoprotein 1, 51kDa (NDUFV1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NDUFV1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: NDUFV1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FMNKPSDGRPKYLVVNADEGEPGTCKDREILRHDPHKLLEGCLVGGRAMG

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NDUFV1 Blocking Peptide, catalog no. 33R-2999, is also available for use as a blocking control in assays to test for specificity of this NDUFV1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDUFV1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NDUFV1

Target: NDUFV1 (NADH Dehydrogenase (Ubiquinone) Flavoprotein 1, 51kDa (NDUFV1))

Alternative Name: NDUFV1 (NDUFV1 Products)

Synonyms: GB17095 antibody, uqor1 antibody, DDBDRAFT_0188174 antibody, DDBDRAFT_0191420 antibody, DDB_0188174 antibody, DDB_0191420 antibody, wu:fc01f01 antibody, wu:fc12f12 antibody, zgc:86620 antibody, CI-51kD antibody, CI-51K antibody, CI51KD antibody, UQOR1 antibody, NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial antibody, NADH:ubiquinone oxidoreductase core subunit V1 antibody, NADH dehydrogenase ubiquinone flavoprotein 1 antibody, NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa antibody, NADH dehydrogenase (ubiquinone) flavoprotein 1 antibody, NADH:ubiquinone oxidoreductase core subunit V1 L homeolog antibody, LOC408367 antibody, NDUFV1 antibody, ndufv1 antibody, Ndufv1 antibody, LOC100179486 antibody, ndufv1.L antibody

Background: The NDUFV1 gene encodes the 51 kDa subunit of complex I (NADH:ubiquinone oxidoreductase) of the mitochondrial respiratory chain.

Molecular Weight: 51 kDa (MW of target protein)