METTL1 antibody (Middle Region)
-
- Target See all METTL1 Antibodies
- METTL1 (Methyltransferase Like 1 (METTL1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This METTL1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- METTL1 antibody was raised against the middle region of METTL1
- Purification
- Purified
- Immunogen
- METTL1 antibody was raised using the middle region of METTL1 corresponding to a region with amino acids KGQLTKMFFLFPDPHFKRTKHKWRIISPTLLAEYAYVLRVGGLVYTITDV
- Top Product
- Discover our top product METTL1 Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
METTL1 Blocking Peptide, catalog no. 33R-4401, is also available for use as a blocking control in assays to test for specificity of this METTL1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of METTL1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- METTL1 (Methyltransferase Like 1 (METTL1))
- Alternative Name
- METTL1 (METTL1 Products)
- Synonyms
- Dmel\\CG4045 antibody, EG:22E5.4 antibody, C12orf1 antibody, TRM8 antibody, TRMT8 antibody, YDL201w antibody, 2810012D02Rik antibody, CG4045 gene product from transcript CG4045-RA antibody, methyltransferase like 1 antibody, methyltransferase like 1 L homeolog antibody, tRNA (guanine46-N7)-methyltransferase antibody, tRNA (guanine-N(1)-)-methyltransferase antibody, tRNA (guanine-N7-)-methyltransferase antibody, CG4045 antibody, METTL1 antibody, Mettl1 antibody, mettl1.L antibody, CAALFM_C404810CA antibody, LOC100280508 antibody, LOC732983 antibody
- Background
- METTL1 contains a conserved S-adenosylmethionine-binding motif and is inactivated by phosphorylation.
- Molecular Weight
- 34 kDa (MW of target protein)
-