LOC653186 antibody (N-Term)
LOC653186
Reactivity: Human
WB
Host: Rabbit
Polyclonal
unconjugated
1 image
-
- Target See all LOC653186 products
- LOC653186
- Binding Specificity
- N-Term
- Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LOC653186 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- LOC653186 antibody was raised against the N terminal of LOC653186
- Purification
- Purified
- Immunogen
- LOC653186 antibody was raised using the N terminal of LOC653186 corresponding to a region with amino acids MKVINAKLDGFYSFPIFLFQFLQATAQEEGIFECADPKLAISAIWTFRDL
-
anti-LOC653186 (LOC653186) antibody
LOC653186 Reactivity: Human WB, ELISA Host: Rabbit Polyclonal unconjugated
-
- Application Notes
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LOC653186 Blocking Peptide, catalog no. 33R-6172, is also available for use as a blocking control in assays to test for specificity of this LOC653186 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LOC653186 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LOC653186
- Alternative Name
- LOC653186 (LOC653186 Products)
- Background
- The function of LOC653186 protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 10 kDa (MW of target protein)
-
You are here:
