C1orf33 antibody
-
- Target See all C1orf33 (MRTO4) Antibodies
- C1orf33 (MRTO4) (mRNA Turnover 4 Homolog (MRTO4))
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This C1orf33 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogen
- MRTO4 antibody was raised using a synthetic peptide corresponding to a region with amino acids SKLKDIRNAWKHSRMFFGKNKVMMVALGRSPSDEYKDNLHQVSKRLRGEV
- Top Product
- Discover our top product MRTO4 Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MRTO4 Blocking Peptide, catalog no. 33R-8557, is also available for use as a blocking control in assays to test for specificity of this MRTO4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MRTO4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- C1orf33 (MRTO4) (mRNA Turnover 4 Homolog (MRTO4))
- Alternative Name
- MRTO4 (MRTO4 Products)
- Synonyms
- mrt4 antibody, wu:fb71a02 antibody, zgc:110388 antibody, C1orf33 antibody, MRT4 antibody, dJ657E11.4 antibody, RGD1311709 antibody, 2610012O22Rik antibody, Mg684 antibody, Mrt4 antibody, MRT4 homolog, ribosome maturation factor L homeolog antibody, MRT4 homolog, ribosome maturation factor antibody, mRNA turnover 4, ribosome maturation factor antibody, mrto4.L antibody, mrto4 antibody, MRTO4 antibody, Mrto4 antibody
- Background
- MRTO4 is a protein sharing a low level of sequence similarity with ribosomal protein P0. While the precise function of the protein is currently unknown, it appears to be involved in mRNA turnover and ribosome assembly.
- Molecular Weight
- 27 kDa (MW of target protein)
-