FNTA antibody (C-Term)
-
- Target See all FNTA Antibodies
- FNTA (Farnesyltransferase, CAAX Box, alpha (FNTA))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FNTA antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- FNTA antibody was raised against the C terminal of FNTA
- Purification
- Purified
- Immunogen
- FNTA antibody was raised using the C terminal of FNTA corresponding to a region with amino acids DNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSTENDSPTNV
- Top Product
- Discover our top product FNTA Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FNTA Blocking Peptide, catalog no. 33R-2083, is also available for use as a blocking control in assays to test for specificity of this FNTA antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FNTA antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FNTA (Farnesyltransferase, CAAX Box, alpha (FNTA))
- Alternative Name
- FNTA (FNTA Products)
- Synonyms
- ATFTA antibody, FARNESYLTRANSFERASE A antibody, FARNESYLTRANSFERASE SUBUNIT A antibody, PFT/PGGT-IALPHA antibody, PLP antibody, PLURIPETALA antibody, farnesyltransferase A antibody, FPTA antibody, PGGT1A antibody, PTAR2 antibody, PFAS antibody, FTA antibody, farnesyltransferase A antibody, farnesyltransferase, CAAX box, alpha antibody, FTA antibody, FNTA antibody, Fnta antibody
- Background
- Prenyltransferases attach either a farnesyl group or a geranylgeranyl group in thioether linkage to the cysteine residue of protein's with a C-terminal CAAX box. CAAX geranylgeranyltransferase and CAAX farnesyltransferase are heterodimers that share the same alpha subunit but have different beta subunits. FNTA is the alpha subunit of these transferases.
- Molecular Weight
- 36 kDa (MW of target protein)
- Pathways
- Response to Water Deprivation, Regulation of G-Protein Coupled Receptor Protein Signaling
-